Details for Mei Locus Pm006454

Position : Pm2 ( 5`- 16909756 .. 16910995 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm006454

Protein [Map View]
MAGLRLLVAAVILGFLSSTSESLRFELQSGHTKCIVEDIKANAMTVGKYSVVNPNEGHPIPDSHKLTVRVTSHYGNNYHY
SELVESGQFAFVAAEAGDYMACFWAPDHKPQITLTIEFDWKTGVAAKDWSNVAKKGSVDVMELELKKLFDTVTSIHEEMF
YLRQREEEMQELNRTTNSRMAWFSLLSLLVCSSVAALQWWHLKTFFEKKKLI

DNA
ATGGCTGGGTTGCGTCTGCTTGTTGCTGCTGTAATCCTAGGGTTTCTGTCGTCTACATCGGAATCTCTGCGGTTCGAGCT
GCAATCGGGCCATACCAAATGCATCGTGGAAGACATAAAAGCCAATGCCATGACGGTCGGTAAGTACAGCGTCGTCAACC
CTAACGAAGGCCACCCCATTCCCGATTCTCACAAGCTCACCGTCAGGGTGACGTCGCACTATGGGAATAACTATCATTAC
TCGGAGCTGGTGGAATCGGGGCAGTTCGCATTTGTGGCGGCGGAGGCGGGAGATTACATGGCCTGCTTCTGGGCGCCTGA
TCACAAGCCCCAAATTACGTTGACCATTGAATTCGATTGGAAGACCGGCGTCGCCGCTAAAGACTGGTCCAATGTGGCCA
AGAAAGGCTCTGTCGATGTTATGGAATTAGAGCTTAAAAAGTTGTTTGATACTGTTACTTCCATTCATGAGGAAATGTTC
TATCTCCGTCAAAGGGAAGAAGAAATGCAGGAGCTTAACAGAACAACGAACTCCAGAATGGCCTGGTTTAGTTTGCTCTC
GCTTCTCGTTTGCTCATCGGTTGCAGCTTTGCAATGGTGGCACTTGAAGACCTTTTTTGAGAAAAAGAAGCTCATCTAA