Details for Mei Locus Pm006449

Position : Pm2 ( 5`- 16897895 .. 16899759 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm006449

Protein [Map View]
MSEVFEGYERQYCELSANLSRKSNSAALLPDHEQKKQRFSEIKVGLDDADALIRKMDLEARSLQPSVKAVLLAKLREYKS
DLNNLKREIKRITSPDANQAAREELLESGMADVHAVSSDQRERMTMSVERLNQSSDRITESRRTILETEELGVSILQDLH
QQRETLLHSHQKLHGVDDAIDKSKRVLTAMSRRMTKHKWIIGSVIGALIVAILFILYFKFSHH

DNA
ATGAGTGAGGTGTTCGAAGGCTACGAGCGTCAGTACTGCGAGCTCTCCGCAAATCTCTCACGAAAATCTAACTCCGCCGC
CCTTCTTCCTGACCATGAGCAGAAGAAGCAGAGGTTTTCTGAGATTAAAGTTGGCTTGGACGATGCTGATGCTTTGATTC
GGAAAATGGACCTTGAGGCCAGAAGCTTGCAGCCGAGTGTAAAGGCCGTGCTTCTTGCTAAGCTAAGGGAATATAAATCC
GATCTCAATAACTTGAAAAGGGAAATCAAAAGAATTACATCACCTGATGCTAATCAGGCTGCTCGCGAAGAGCTGTTGGA
GTCCGGAATGGCTGATGTCCATGCGGTTTCTTCTGATCAAAGAGAGAGAATGACAATGTCTGTTGAGAGATTAAATCAAT
CAAGTGATAGAATCACGGAGAGTAGGAGAACCATACTGGAGACTGAAGAGCTTGGTGTCTCCATTCTCCAAGATTTGCAT
CAACAACGGGAAACTCTCCTGCATTCCCATCAAAAACTTCATGGGGTAGATGACGCCATTGACAAGAGTAAAAGAGTTTT
AACTGCCATGTCACGGAGGATGACCAAGCATAAATGGATCATCGGCTCAGTCATCGGAGCTCTTATCGTTGCAATCCTGT
TTATTCTATATTTTAAGTTTTCTCATCATTAA