Details for Mei Locus Pm006444

Position : Pm2 ( 5`- 16873981 .. 16875899 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm006444

Protein [Map View]
MESHLQHKIQKYEEFVDGRLKPDLVRAIAQRSDLRNNIENLEKNSVTSLRTLVNLGSEVYMQADVQIEEYTNLIASIKAQ
IKLVCEGIRELLQLPmEKHAPERIF

DNA
ATGGAGAGTCACCTTCAACACAAAATACAGAAATACGAGGAATTCGTGGATGGACGTCTCAAACCAGACCTTGTTCGCGC
CATTGCTCAACGCTCGGATTTGCGGAACAACATTGAGAATTTGGAGAAAAACAGTGTAACCAGTCTTAGGACTTTGGTTA
ACCTTGGCTCTGAAGTCTATATGCAAGCTGATGTGCAAATTGAAGAGTATACTAACCTTATTGCATCAATCAAAGCCCAG
ATAAAGCTGGTATGCGAAGGGATCCGAGAATTACTCCAACTTCCAGCAGAGAAACATGCCCCAGAGCGAATTTTTTGA