Details for Mei Locus Pm006443

Position : Pm2 ( 5`- 16872160 .. 16873233 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm006443

Protein [Map View]
MEAYTDNSPRMRLDHSKKEGSEETHLLRFELEPPGNDHRFHSMNALEILRETVRILRYNSWGFLAIAALLICPLSALLLS
NLLVDQSLVKRLTIRMLLIAKSSGLPLRDFISHSCQRFAEMAISSTMCFPLYITLSLLSKAAVVYSVYCSYSLKKFDVSQ
FYLIMCKIWRRLLSTYVWMCMVVVGCLILFLILLLAVCNTCSIVGLSPPHIVYAAMAVGLIFSVIFANAIIICNIAIVIS
VLEDVSGPEALVQSGVLIKGQTQVGLLIFLGSTIGMAFVEGLFEHRVKTLSYGDGSSRVWEGPLLVIMYSFVVLIDSMMS
AVFYFSCRSFKMETSLDSESHSILETINFSSESVGIQ

DNA
ATGGAAGCTTATACTGACAATTCCCCAAGAATGAGATTGGATCATTCAAAGAAAGAGGGATCCGAAGAAACCCATTTGTT
GAGATTTGAGTTAGAACCTCCTGGTAACGATCATAGGTTCCATTCAATGAATGCTCTGGAGATTTTGAGGGAAACTGTGA
GAATTCTCCGGTACAATTCGTGGGGCTTTTTGGCCATTGCCGCCTTGCTAATTTGCCCTTTGTCTGCCTTGCTTTTGTCG
AATTTGCTAGTTGATCAGTCACTTGTAAAGAGACTAACCATTAGGATGTTGTTAATTGCCAAGTCCAGTGGCCTCCCTTT
GAGGGATTTTATCAGTCATTCTTGCCAGAGGTTTGCTGAGATGGCTATCTCATCCACTATGTGCTTTCCTCTGTACATCA
CATTGTCTTTGTTGTCGAAAGCCGCCGTGGTTTACTCTGTGTATTGTAGTTACTCCCTGAAGAAGTTTGATGTATCCCAG
TTTTACTTAATTATGTGCAAAATATGGAGACGGCTTCTTTCGACGTATGTGTGGATGTGTATGGTGGTTGTGGGTTGCCT
CATCTTGTTTTTGATTCTTCTTCTTGCTGTGTGCAATACATGTTCCATAGTTGGGTTGTCACCTCCTCATATTGTATATG
CTGCAATGGCGGTTGGCCTCATCTTCTCGGTTATTTTTGCCAATGCTATTATTATTTGCAACATTGCTATTGTGATCTCT
GTGTTGGAGGATGTCTCAGGACCAGAGGCATTGGTTCAGTCTGGGGTTTTAATCAAGGGCCAGACTCAGGTGGGTCTTTT
GATATTTCTTGGATCAACAATCGGAATGGCATTTGTTGAGGGGCTGTTTGAGCACAGAGTGAAGACGTTGAGCTACGGAG
ATGGGTCTTCTCGCGTATGGGAAGGGCCTCTTTTGGTGATCATGTATTCGTTCGTGGTGCTCATCGACTCCATGATGAGT
GCTGTTTTCTACTTCAGCTGCAGATCTTTTAAGATGGAAACATCTTTAGACAGCGAGTCTCATTCAATTTTGGAAACCAT
AAACTTTTCTTCTGAATCAGTTGGTATTCAATGA