Details for Mei Locus Pm006437

Position : Pm2 ( 5`- 16831948 .. 16835159 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm006437

Protein [Map View]
MEVSNTKQQHQSASISLTKPVRCIVKLGGAAITCKNELETINEENLKTVSSQLRQSMTTGSNSGEVLGMDWSKQPGESEI
SSTLSDFEDRPVVDSSPFIVVHGAGSFGHFQASKSGVHKGGLYQPLVKAGFVATRISVTKLNLEIVRALAREGIPSIGMS
PFSCGWSTRERNIASADLSAVAKAIESGLVPVLHGDAVLDDLLDCTILSGDVIISHLAAHLKPEYVVFLTDVSGVYDRPP
SDPNAVLLREIAVAKDGSWSIEKPTFQNKNKQVETSVAAHDTTGGMLTKISEAAAIAKLGIDVYIVKAATSHALKAFSGE
LKDNLPDDWLGTAIRFSNK

DNA
ATGGAGGTGAGCAACACAAAGCAGCAGCACCAAAGCGCTTCCATCAGTCTAACGAAACCAGTTCGTTGCATCGTCAAACT
CGGAGGTGCAGCAATTACTTGCAAGAATGAATTAGAGACCATAAATGAAGAAAATCTGAAGACAGTTTCCTCGCAGCTGA
GGCAATCAATGACCACGGGGTCGAATTCTGGGGAGGTTCTTGGGATGGATTGGAGCAAGCAACCCGGAGAATCAGAAATC
TCATCTACCCTAAGTGATTTTGAAGATCGGCCAGTTGTGGATTCCAGCCCTTTTATAGTTGTTCATGGAGCAGGTTCTTT
TGGGCATTTTCAAGCTAGTAAATCTGGGGTCCATAAAGGTGGATTGTACCAACCCCTTGTGAAGGCTGGTTTTGTTGCCA
CACGCATCTCTGTTACAAAGCTCAATCTTGAAATTGTTAGAGCGCTAGCTAGGGAGGGTATTCCTTCCATAGGAATGTCT
CCATTTTCATGTGGATGGTCAACCCGTGAAAGAAATATAGCTTCAGCTGATTTGTCTGCAGTGGCTAAGGCTATTGAATC
TGGTTTAGTACCTGTTTTGCATGGAGATGCCGTGCTCGATGACTTACTGGACTGTACCATCTTGAGTGGAGATGTCATCA
TCAGTCATCTTGCAGCCCACTTGAAGCCTGAATACGTTGTTTTTCTCACTGATGTTTCGGGAGTTTATGATCGTCCACCA
TCAGATCCAAATGCAGTACTCTTGAGAGAAATTGCTGTGGCTAAAGATGGGAGCTGGTCGATCGAGAAGCCAACATTTCA
GAACAAGAACAAGCAAGTTGAAACAAGTGTAGCAGCCCATGATACAACCGGTGGAATGCTGACCAAGATATCTGAAGCTG
CAGCGATTGCGAAACTCGGAATTGATGTATATATTGTAAAGGCAGCTACAAGCCATGCATTGAAAGCCTTTAGTGGAGAA
TTGAAGGACAACCTTCCTGATGACTGGCTTGGAACCGCGATCCGGTTTTCCAATAAATGA