Details for Mei Locus Pm006436

Position : Pm2 ( 5`- 16826015 .. 16831000 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pm006436

Protein [Map View]
MSGAALKFENPIRDAISRIRFAPKSDNLLISSWDSSLRLYDVGNSALRLEASSEAALLDCCFQNESVAFSAGSDGFIRRY
DLHSGIHDSIGNHDDTSTCVGYSDETCQVITAGLDKKILSWDTRTPKGIACVRNMDSEVMSMSLSGFDMMVAVGASIYVY
DLRRLEKPFQSKDSHMGVQIVCVSSIPYAKGFAVGSVDGRVALEISCPSNSDDIRYMFRCHPKSTDSKYHLVSVNDIVFN
PIIYGAFVTGDNEGYVTAWDATSKRRLFQRSEPmMSDEEHHFESKADAGASKTYPQQAGTIRKNGYIVIKGRPCKVVEVS
TSKTGKHGHAKCHFVGIDIFTAKKLEDIVPSSHNCDVPHVNRTDYQLIDISEDGFVSLLTENGNTKDDLRLPTDDSLLTQ
IKDGFGEGKDLVVSVMSAMGEEQICALKDIGPK

DNA
ATGAGCGGAGCTGCCTTGAAGTTCGAAAACCCGATCCGAGATGCAATTTCCAGAATTCGGTTCGCTCCGAAATCAGACAA
CCTCCTCATCTCTTCTTGGGACTCTAGCCTGAGATTGTACGACGTCGGAAACTCGGCACTCAGGTTAGAAGCTTCGTCGG
AAGCTGCGCTCCTCGATTGTTGCTTCCAAAACGAGTCCGTCGCTTTTAGCGCTGGCTCTGATGGCTTCATTAGAAGGTAT
GACTTGCATTCTGGAATTCATGATTCAATTGGAAATCATGATGACACATCAACATGTGTTGGATATTCTGATGAAACCTG
CCAAGTAATCACTGCTGGTTTGGATAAGAAGATATTGTCATGGGACACACGTACGCCGAAGGGTATTGCATGTGTAAGAA
ATATGGATTCAGAGGTGATGTCCATGTCACTCTCAGGCTTTGATATGATGGTAGCTGTTGGAGCATCAATATATGTATAT
GATTTGCGCAGGCTAGAAAAACCATTTCAATCAAAAGATTCGCATATGGGTGTTCAGATTGTATGCGTTAGTTCAATTCC
GTATGCTAAAGGTTTTGCAGTTGGCTCAGTAGATGGACGTGTAGCATTGGAGATTTCCTGCCCATCGAATTCAGATGACA
TCAGATATATGTTCCGGTGTCATCCAAAGTCAACTGACAGCAAATATCATCTGGTGTCGGTGAATGACATTGTATTCAAT
CCGATCATCTACGGTGCCTTTGTTACTGGTGACAATGAGGGTTATGTTACTGCATGGGATGCTACAAGCAAAAGGAGGCT
GTTTCAGCGCTCAGAACCAGCCATGTCGGACGAGGAGCATCACTTCGAATCCAAGGCTGACGCCGGAGCTTCCAAGACCT
ATCCTCAGCAAGCTGGCACTATCCGCAAGAACGGTTACATTGTCATCAAGGGCAGGCCCTGCAAGGTTGTGGAGGTTTCC
ACTTCCAAGACTGGAAAGCACGGACATGCCAAGTGTCACTTTGTTGGTATTGATATCTTCACTGCCAAGAAGCTTGAGGA
TATTGTTCCGTCTTCCCACAATTGTGATGTTCCCCATGTCAACCGTACTGACTACCAGCTGATTGATATCTCTGAGGATG
GATTTGTGAGTCTGCTGACTGAGAATGGTAACACCAAGGATGACCTGAGGCTTCCAACCGATGACAGTCTGCTTACGCAG
ATCAAGGATGGCTTTGGTGAGGGGAAGGATCTGGTTGTTTCTGTCATGTCTGCTATGGGAGAGGAGCAGATTTGTGCTCT
CAAGGACATTGGTCCAAAATAG