Details for Common bean Locus Phvul.010G138400

Position : Chr10 ( 5`- 41050626 .. 41053322 -3` )
Annotation :
External links : CoGe
PGDD synteny : Phvul.010G138400

Protein [Map View]
MDHYGSSGGSWTMIPTHTSNVQSQSQSQSNQDPNLFLQQQQQQFLQPQPFQQALQPQSPFQQHQHLYQQQQQQQQRLLQQ
QQQQQQQQNLHQSLASHYHLLHLVENLSEVIEHGTPDQQSDALINELSNHFEKCQQLLNSISDSISTKAMTVEGQKKKQE
ESEQLLNQRRDLIANYRKSVEELVRSEP*

DNA
ATGGATCACTATGGTTCTTCTGGAGGAAGCTGGACTATGATCCCAACTCACACTTCAAATGTTCAATCCCAATCCCAATC
CCAATCGAACCAGGACCCTAACCTCTTTCTTCAACAACAACAACAACAGTTTCTCCAGCCACAACCTTTTCAGCAAGCAC
TACAACCTCAATCTCCATTTCAACAGCACCAGCACCTTTATCAGCAGCAGCAACAACAGCAGCAACGTCTGCTACAGCAA
CAGCAACAGCAGCAGCAGCAGCAGAACCTTCACCAATCACTGGCCTCTCACTACCATCTCTTACATTTGGTGGAGAATTT
GTCTGAGGTTATTGAACATGGAACCCCAGATCAGCAATCAGATGCATTGATCAATGAGTTGAGTAACCACTTTGAGAAGT
GCCAGCAGCTGTTAAACTCAATCTCGGACTCGATTAGCACCAAGGCTATGACAGTCGAGGGACAGAAGAAGAAGCAAGAG
GAAAGTGAGCAGTTGCTAAATCAGCGAAGAGACTTGATTGCCAATTACAGAAAATCTGTGGAGGAGCTTGTTAGGTCTGA
GCCATAA