Details for Common bean Locus Phvul.009G043600

Position : Chr09 ( 5`- 8504164 .. 8508829 -3` )
Annotation :
External links : CoGe
PGDD synteny : Phvul.009G043600

Protein [Map View]
MRALFSNMKGFLLLVWLLEVVCVAVAAVNPSLNDDVLGLIVFKADIRDPKGKLASWSEDDESACGAGWVGVKCNPRSNRV
VEINLDGFSLSGRIGRGLQRLQFLRKLSLANNNLTGGINSNIARIDSLRVIDLSGNSLSGQVSDDVFRQCGSLRAVSLAR
NRFSGSIPSALGACSALAAIDLSNNQFSGSVPSGVWSLSALRSLDLSDNLLEGEIPKGVEAMKNLRSVSLARNRLTGNVP
GGFGSCSLLRSIDLGDNSFSGSIPGDFKELALCGYLSLRGNAFSGELPEWIGEMRGLETLDLSNNGLTGQVPNSVGNLQS
LKMLNFSGNSFGGSLPESMANCTKLLVLDASRNSMSGGLPLWIFKSDLDKVLLSENGASGSKKSPLISLAEVAVQSLQVL
DLSHNAFSGEITSAVGGLSSLHVLNLANNSLIGPIPAAIGGAVSLKELVLKKNFLIGKIPMSIENCTLLTTLSLSQNWLS
GPIPAAVAKLTNLQTVDLSYNNLTGNLPKQLANLANLLAFNLSHNNLQGELPAGGFFNTISPTSVSGNPSLCGAAVNKSC
PAVLPKPIVLNPNTSTDASPGALPQNLGHKRIILSISALIAIGAAAVIVIGVISITVLNLRVRSSTSRDAGALTFSAGDE
FSRSPTTDANSGKLVMFSGEPDFSSGAHALLNKDCELGRGGFGAVYQTVLRDGHSVAIKKLTVSSLVKSQEDFEREVKKL
GKIRHQNLVELEGYYWTPSLQLLIYEYVSGGSLYKHLHEGSGGNFLSWNERFNVILGTAKALAHLHQSNIIHYNIKSTNV
LLDSYGEAKIGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVTGKRPVEYMEDDVV
VLCDMVRGALEEGRVEECIDERLEGKFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEGQEELG*

DNA
ATGCGAGCGTTATTTTCGAACATGAAAGGTTTTCTTTTACTTGTGTGGTTGTTGGAGGTGGTTTGTGTGGCGGTGGCGGC
GGTGAACCCCTCTCTGAACGATGACGTTTTGGGGCTGATTGTGTTCAAGGCTGACATACGAGATCCGAAGGGCAAGCTTG
CGTCTTGGAGCGAGGACGATGAGAGTGCGTGTGGAGCTGGTTGGGTTGGGGTGAAGTGCAACCCTAGATCCAACAGAGTG
GTGGAGATTAACCTTGATGGGTTTTCTCTCTCTGGGAGAATAGGTCGAGGGTTGCAAAGGTTGCAGTTTCTAAGGAAGCT
TTCTCTGGCGAACAACAACCTCACTGGGGGGATAAACTCCAACATTGCTCGAATAGATAGTCTTAGGGTCATCGACTTGA
GTGGCAATAGTCTCTCAGGGCAGGTGTCCGATGATGTTTTCCGACAATGTGGGTCTCTCAGGGCTGTTTCCTTGGCTAGG
AACAGGTTTTCTGGGTCCATTCCTTCTGCTTTGGGGGCGTGTTCTGCTCTTGCTGCTATAGACCTTTCTAATAACCAGTT
TTCTGGTTCTGTCCCCTCCGGGGTTTGGTCTTTGAGTGCTCTTAGGTCCTTGGATTTGTCTGATAACTTGTTGGAGGGAG
AGATTCCTAAGGGGGTTGAGGCCATGAAGAATTTAAGGAGTGTTAGCTTGGCCAGGAATCGTTTAACTGGGAATGTTCCT
GGTGGGTTTGGGAGCTGTTCGCTTTTGAGGTCCATTGATTTGGGGGATAATTCATTTTCTGGGAGTATTCCTGGTGATTT
CAAGGAACTTGCATTGTGTGGTTACCTTAGTTTGCGAGGGAATGCTTTTTCTGGAGAGCTTCCTGAGTGGATTGGGGAGA
TGAGAGGTCTTGAAACGTTGGACCTTTCAAACAATGGGCTTACTGGTCAGGTTCCAAACTCTGTTGGAAATCTTCAGTCA
TTGAAGATGTTGAATTTTTCTGGGAATAGTTTCGGTGGTAGTCTTCCTGAGTCTATGGCTAATTGTACGAAACTTTTGGT
GTTGGATGCCAGCCGGAATTCGATGTCCGGGGGGCTTCCATTGTGGATTTTCAAGTCAGATTTGGACAAGGTTTTGTTGT
CGGAAAATGGCGCAAGTGGTAGCAAGAAAAGCCCTTTGATTTCCTTGGCTGAAGTTGCAGTTCAGAGTCTTCAAGTTTTG
GATTTGTCTCACAATGCATTTTCTGGTGAAATCACATCTGCTGTTGGAGGTTTAAGCAGCTTGCATGTTTTGAATTTAGC
AAATAACTCTCTTATAGGTCCTATACCAGCTGCAATTGGAGGAGCTGTGTCCTTGAAAGAACTGGTACTGAAAAAGAACT
TCCTAATTGGGAAAATTCCAATGTCAATTGAGAACTGCACTTTGCTAACTACTCTGAGCCTATCCCAGAACTGGCTGAGT
GGCCCTATACCTGCAGCAGTTGCAAAACTTACCAACCTGCAAACTGTGGACTTATCTTACAACAACCTTACTGGAAACCT
TCCTAAGCAACTGGCCAACCTTGCCAATCTTCTTGCATTCAATTTATCTCACAACAACCTTCAGGGTGAACTGCCGGCTG
GTGGTTTTTTCAACACCATTTCACCCACCTCTGTTTCTGGCAATCCATCACTTTGTGGAGCTGCAGTAAACAAATCATGC
CCTGCTGTCCTCCCAAAGCCTATTGTTCTAAATCCCAACACTTCTACTGACGCAAGCCCGGGTGCATTGCCTCAAAATTT
GGGTCACAAAAGAATCATTCTCAGCATTTCGGCACTCATTGCCATTGGTGCAGCTGCTGTCATTGTAATTGGTGTTATTA
GCATCACCGTTCTCAATCTCCGTGTTCGGTCCTCCACATCACGAGATGCAGGTGCCCTCACATTTTCTGCAGGAGATGAA
TTCAGCCGTTCCCCTACTACAGATGCCAACTCTGGCAAGCTTGTGATGTTTTCTGGTGAGCCAGATTTCAGTTCTGGTGC
GCATGCTTTGCTGAATAAGGACTGTGAGCTTGGGCGTGGAGGATTTGGTGCAGTGTACCAAACGGTTCTTAGAGATGGGC
ATTCAGTTGCAATAAAGAAGCTCACTGTATCAAGCCTTGTGAAGTCTCAAGAAGATTTTGAAAGAGAAGTAAAAAAGTTG
GGAAAAATCAGACACCAAAACCTGGTGGAACTTGAGGGTTATTATTGGACTCCATCGCTGCAGCTTCTTATATACGAGTA
CGTCTCCGGTGGCAGTCTGTATAAGCATCTCCATGAAGGATCTGGTGGAAACTTCCTCTCATGGAATGAGAGATTTAATG
TGATTCTGGGAACGGCCAAGGCCTTGGCACACTTGCACCAGTCCAACATTATTCACTATAACATAAAGTCAACCAATGTC
CTTCTTGACAGTTATGGTGAAGCAAAGATAGGGGACTTTGGCCTAGCAAGGCTGTTACCAATGCTTGACCGATATGTGTT
GAGCAGCAAAATTCAGAGTGCACTGGGATACATGGCACCGGAGTTTGCGTGCAAAACAGTGAAAATCACTGAGAAGTGTG
ATGTATATGGGTTTGGGATCCTGGTTTTGGAGATAGTAACAGGGAAGAGGCCAGTTGAATACATGGAGGATGATGTGGTG
GTACTTTGTGACATGGTGAGAGGCGCTTTGGAAGAAGGTAGAGTGGAGGAATGCATTGATGAGAGGCTTGAAGGGAAATT
CCCAGCAGAAGAAGCCATTCCTGTAATGAAGTTAGGCTTAATATGTACTTCTCAAGTGCCATCTAACAGGCCTGACATGG
GAGAGGTAGTTAACATATTGGAGCTCATAAGATGTCCCTCTGAAGGACAAGAAGAATTGGGATGA