Details for Common bean Locus Phvul.009G043100

Position : Chr09 ( 5`- 8430030 .. 8432516 -3` )
Annotation :
External links : CoGe
PGDD synteny : Phvul.009G043100

Protein [Map View]
MSKRVITELVLGLDYATQLKFLLQNPVGPDGSVAAKELVTNVQRSFAETLSLLTSSEAASGEDEVAQNLVISGEDASQAA
SIDIRSEDSTESRKRSLPLSKDRRGSYKRRKTEQTWSIVSQTTDDNHAWRKYGQKDILNSQFPRSYFRCTRKFEQGCKAM
KQVQRLEENPDMYNITYIGLHTCKDTLKAPQMVTYETWDSFLENSHADLNVPNEQKQHDPPIRSQSPIVKQEYPNDESDP
TDADLWSDLKDFELSNEKPGFKIVSENADAFMFWLPEFGHEC*

DNA
ATGAGCAAAAGGGTCATAACAGAGCTTGTTCTGGGTCTCGACTATGCCACTCAGCTCAAGTTTCTGCTTCAGAACCCTGT
TGGCCCAGATGGGTCTGTTGCAGCTAAAGAACTTGTGACCAATGTGCAGAGATCTTTCGCTGAAACTCTTTCTTTGTTGA
CTTCTTCCGAGGCTGCAAGTGGTGAAGACGAGGTTGCTCAGAATCTCGTGATTTCCGGGGAAGATGCCTCGCAGGCTGCA
AGCATTGATATTAGGTCTGAGGATTCAACTGAGAGTAGAAAGAGATCGTTGCCCCTCTCAAAGGATCGCAGAGGTTCCTA
CAAAAGAAGGAAGACTGAACAGACATGGTCCATAGTTTCCCAGACCACTGATGATAATCATGCATGGAGAAAGTACGGAC
AAAAGGATATTCTAAATTCTCAGTTTCCTAGGAGTTACTTCAGATGCACTAGGAAGTTTGAACAAGGTTGCAAAGCCATG
AAACAGGTGCAACGGTTAGAAGAGAATCCTGATATGTACAATATTACGTATATTGGGCTCCACACATGCAAAGACACCCT
CAAGGCTCCACAAATGGTCACATATGAAACTTGGGACTCATTTCTTGAGAATTCCCACGCAGACTTAAATGTTCCAAATG
AACAAAAGCAACATGATCCTCCTATCAGATCACAAAGCCCAATTGTTAAACAAGAATATCCCAATGATGAGAGTGATCCT
ACAGATGCCGACCTGTGGTCTGATTTGAAGGATTTTGAACTGTCCAATGAGAAGCCTGGCTTCAAAATAGTCTCTGAAAA
TGCAGATGCATTCATGTTCTGGCTCCCGGAGTTTGGACATGAATGTTGA