Details for Common bean Locus Phvul.009G042600

Position : Chr09 ( 5`- 8386053 .. 8389412 -3` )
Annotation :
External links : CoGe
PGDD synteny : Phvul.009G042600

Protein [Map View]
MSVRVVRCPKCRLLLEEPTGCDLYKCGECGTILEAKKRTSVTVNLESSTQETIAATRKHLVPSRECSLKEKSTSSAECVV
DGNSGRGQLVPFILSDEGQETESDIYNLSHRRHRMSSKGCSTSNKTTQSEIEEVNEGKLLEELREELVCAQDEDGYNDRS
ASTLIRVTSEKKNTEVDLEGVEEFISETDRENANKNKSVVVAALPEVEITESVDSEEAEELNGGNLSSDEAEEEFSSALE
EEDANNYKSSPVGENLELKITESNRAEELNDGKLFEGAEHAPDGEDFNNNPSAIDGAKPEVDTTESASTTIRSSTEEDNI
LHVTPDKLEGPPANLVSSHKQQKQAQKDVHRGFDRVRSVHTTELIDHSSELSDILVGKLSKSPTARSSHAYYNGSLSSYD
AMDERSPIKHSGPFDYTHTIGNDVSEGRTRKGKGLVNNLFYGGVGTQRQSHLTNAKHHAKKDGWGNQSKAVEETTRNGHR
HWKSRQRDEFPPKIPFHRGGSRSYYERGSSSDHMHGEIHRSSSFLSHESFEETDPEKMKLLSMIHKLQDQLNRTSYSSGE
INGRLSKGVSYKGNRIPAYHTRDFDEARRFSHGLDYPLCNGRCSHGVNWHQRHNQSSLPYSAEATSSALHVDHSCYHCRS
QERHFSADISPHVRFQHERIHRSCAGRDCCSFSHHSYPSSPQWFTDSKLPPMYGRETKSDDQRRRVPELSRYLREKRNLV
AKRHHRPVAGGAPFVTCHKCLNLLQLPADFLLFKRACHQLKCGECSEVLKFSLHGSHIDLFSPNNATGHPSSDLNDQSQV
ISSSSLPSASHAKYYRYSPAGAISYYDDYGLSISKSYSSEGEPISLAHSHHLHGSEYDNSRVSRGIFEPSTEKENIAPRY
SSARKSSEETDESAIFPTNMSGSRKLASEMRAKPPPKSSSLHLLMGYSSPSQVYKRASDFC*

DNA
ATGTCTGTTCGGGTAGTTAGATGCCCTAAATGTCGGTTACTTCTTGAAGAGCCTACAGGATGTGATTTGTACAAGTGTGG
TGAATGTGGTACTATTCTTGAAGCTAAGAAACGAACAAGTGTGACTGTGAACTTAGAATCCAGTACACAAGAAACTATTG
CAGCTACTAGAAAGCATCTGGTTCCTTCTCGGGAATGTAGTTTGAAGGAAAAATCAACTTCCTCTGCAGAATGTGTTGTG
GATGGAAATAGTGGAAGGGGTCAACTTGTTCCGTTTATTTTATCAGATGAAGGACAAGAAACTGAGTCAGATATCTATAA
TTTGTCACACAGAAGGCACAGAATGTCCAGCAAAGGTTGTTCAACTTCAAATAAGACCACTCAGTCTGAGATTGAGGAGG
TAAATGAAGGAAAGTTGTTAGAAGAATTGAGAGAGGAGTTGGTTTGTGCACAGGATGAAGATGGCTATAACGATAGATCA
GCTTCAACTCTGATAAGGGTAACATCTGAAAAGAAGAATACCGAAGTTGACTTAGAAGGAGTGGAAGAGTTCATTTCTGA
GACAGACAGAGAAAATGCCAACAAAAACAAATCAGTTGTAGTAGCTGCTCTCCCTGAAGTGGAAATTACTGAAAGTGTTG
ATTCAGAAGAAGCAGAAGAGTTAAATGGTGGAAACTTGTCATCAGACGAAGCAGAAGAGGAGTTTAGTTCTGCATTGGAG
GAAGAAGATGCCAATAATTATAAATCAAGTCCAGTTGGTGAAAACCTTGAACTGAAAATCACTGAAAGCAATAGAGCAGA
AGAGTTAAATGATGGAAAATTGTTTGAGGGAGCAGAACATGCACCCGATGGAGAAGATTTCAACAACAATCCATCAGCCA
TAGATGGTGCAAAACCTGAAGTGGACACAACAGAAAGTGCTTCTACTACTATAAGGTCAAGTACAGAGGAGGATAACATT
TTACACGTTACGCCTGATAAACTTGAAGGGCCACCTGCTAATCTTGTATCCTCTCATAAACAACAGAAGCAAGCTCAAAA
AGATGTTCACCGTGGTTTTGACCGTGTAAGGTCTGTGCATACGACAGAATTAATTGATCACAGTTCAGAGCTTAGTGATA
TTCTTGTTGGAAAACTGTCCAAGTCCCCAACTGCTAGAAGCTCTCATGCTTATTATAATGGCAGCCTTTCTTCTTATGAT
GCAATGGATGAGCGGTCCCCTATCAAACATTCAGGTCCGTTTGACTACACTCACACCATTGGTAATGATGTTTCTGAGGG
AAGGACCAGAAAGGGTAAAGGTCTTGTTAATAACTTGTTCTATGGAGGCGTTGGAACACAACGTCAATCACATTTGACCA
ATGCGAAGCATCATGCCAAGAAAGATGGTTGGGGGAATCAAAGCAAAGCGGTGGAGGAGACTACAAGAAATGGTCATCGA
CACTGGAAGAGCAGACAGAGAGACGAGTTTCCTCCCAAAATTCCTTTTCATCGAGGTGGTTCTCGTTCTTACTATGAAAG
GGGAAGCTCATCAGACCATATGCATGGTGAGATCCACCGCAGCTCGAGCTTTCTTTCGCATGAATCCTTTGAGGAAACTG
ACCCAGAGAAGATGAAACTGTTGAGCATGATTCATAAGTTGCAGGATCAACTGAACAGGACTTCCTACTCGAGTGGGGAA
ATAAATGGAAGACTGTCCAAGGGTGTCTCTTACAAGGGAAATCGTATTCCTGCATATCATACCCGTGACTTTGATGAGGC
GAGAAGGTTTTCTCACGGTTTGGATTACCCTTTGTGTAATGGAAGATGTAGTCATGGAGTCAACTGGCACCAAAGGCATA
ATCAATCCTCACTACCCTATTCAGCTGAGGCAACAAGCAGTGCACTCCATGTTGATCATTCTTGCTACCATTGTCGTTCC
CAAGAGAGGCACTTTTCAGCAGATATCTCACCACATGTTCGTTTCCAGCATGAAAGGATACATAGGTCCTGTGCAGGCCG
AGATTGTTGCTCTTTTTCTCATCACTCCTATCCTTCAAGTCCACAATGGTTCACAGATTCTAAACTTCCACCAATGTACG
GACGTGAAACAAAATCTGATGATCAGAGGCGTAGGGTTCCTGAGTTAAGTAGATATTTAAGGGAGAAAAGGAACTTGGTT
GCTAAGAGACATCACAGGCCAGTGGCAGGTGGAGCTCCTTTTGTCACTTGTCATAAATGCTTAAACCTGTTGCAGCTACC
TGCAGATTTTCTCTTATTCAAAAGGGCATGTCATCAGCTGAAATGTGGTGAATGTTCAGAAGTGCTCAAGTTTTCACTTC
ATGGAAGCCATATAGATTTATTTTCACCAAATAATGCTACTGGCCATCCATCAAGCGACCTTAATGACCAAAGCCAGGTG
ATTAGTAGCAGCAGTCTACCTTCAGCATCTCATGCAAAGTATTACCGTTATTCACCTGCAGGGGCCATTTCATATTATGA
TGATTATGGTCTTTCTATCTCTAAAAGCTACTCCTCAGAAGGAGAGCCTATTTCTTTGGCACATTCTCATCACTTGCATG
GTAGTGAATATGATAATTCAAGAGTCTCTCGTGGTATATTTGAGCCATCAACTGAGAAGGAGAACATTGCTCCAAGATAT
TCTAGTGCAAGGAAGAGTTCGGAGGAGACAGATGAATCAGCTATCTTTCCCACCAATATGTCTGGATCTAGGAAATTGGC
ATCAGAAATGCGGGCAAAGCCACCACCAAAAAGTTCATCACTTCATCTACTGATGGGATATTCTTCACCAAGTCAAGTAT
ATAAGAGGGCCTCGGACTTCTGTTGA