Details for Pear Locus Pbr029920.1

Position : scaf_51.0 ( 5`- 87404 .. 89085 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr029920.1

Protein [Map View]
MSEVFEGYERQYCELSANLSRKSNSAALLSDYEQKKQKFSEIKVGLDDAEALIRKMDLEARSLQPSVKAVLLAKLREYKS
DLNKLKREIKRVASPDATQAARDELLEAGMAGTHAVSSDQRERMAMSVERLNESSDRITQSRRTILETEELGVSILQDLH
QQRETLLHSHQKLHTVDDAIDKSKRVLTAMSRRMTKHKWIIGSVIGALIVAILFILYFKLSH*

DNA
ATGAGTGAGGTGTTCGAAGGCTACGAGCGTCAGTACTGCGAACTCTCCGCAAACCTCTCGCGAAAATCCAACTCCGCCGC
TCTTCTTTCCGACTATGAGCAGAAGAAGCAGAAGTTTTCTGAGATTAAAGTTGGATTGGATGATGCCGAAGCTTTGATTC
GGAAAATGGACCTCGAAGCCAGAAGCTTGCAGCCAAGCGTGAAGGCGGTGCTTCTTGCCAAGCTAAGGGAATATAAATCT
GATCTCAATAAGTTGAAAAGGGAAATCAAGAGAGTTGCATCGCCTGATGCCACTCAGGCTGCTCGCGATGAACTGCTGGA
GGCAGGAATGGCTGGTACGCATGCGGTTTCTTCTGATCAAAGAGAGAGAATGGCAATGTCTGTTGAGAGATTAAATGAAT
CAAGTGATAGAATCACACAGAGTAGAAGAACAATATTGGAAACTGAAGAGCTTGGTGTCTCCATTCTCCAAGATTTGCAC
CAACAGCGGGAAACTCTCCTGCATTCCCATCAAAAACTTCATACCGTAGATGACGCCATTGACAAGAGTAAAAGAGTTTT
AACTGCCATGTCAAGGAGGATGACGAAGCATAAATGGATCATAGGCTCAGTTATCGGAGCTCTTATTGTTGCAATCCTCT
TTATTCTGTACTTTAAGCTTTCTCATTAA