Details for Pear Locus Pbr029917.1

Position : scaf_51.0 ( 5`- 78115 .. 79848 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr029917.1

Protein [Map View]
MVGLRLLLATVIAGFLLSTSECLRFELQSGHTKCIVEDIKSSAMTVGKYSVVNPNEGQPMPNSHKLTVRVTSHYGNSYHF
SELVESGQFAFVAAEAGDYMACFWAPVFKPETTLTIEFDWKTGVAAKDWSNVAKKGTVDVMELELKKLFDTVTSIHEEMF
YLREREGEMQDLNRATNSKMAWLSLLSLIVCLSVAGLQVWHLKTFFEKKKVI*

DNA
ATGGTCGGATTGCGTCTTCTACTTGCTACCGTGATCGCAGGGTTTTTATTGTCTACATCCGAATGTCTGCGGTTCGAGCT
GCAATCGGGTCACACGAAATGCATCGTGGAAGATATAAAATCCAGCGCCATGACCGTCGGAAAATACAGCGTCGTCAACC
CCAACGAAGGCCAGCCCATGCCCAATTCTCACAAATTGACCGTCCGGGTGACGTCGCACTACGGAAATAGCTATCACTTT
TCGGAGCTGGTGGAATCGGGGCAGTTTGCGTTTGTGGCGGCGGAGGCGGGAGATTACATGGCGTGCTTCTGGGCGCCGGT
TTTCAAGCCCGAGACGACGTTGACCATCGAATTCGATTGGAAAACCGGCGTCGCCGCCAAAGACTGGTCCAATGTCGCCA
AGAAAGGCACCGTTGACGTCATGGAATTGGAGCTTAAAAAGTTGTTTGATACGGTTACTTCCATTCACGAGGAGATGTTC
TATCTCCGCGAAAGGGAAGGAGAGATGCAGGATCTTAACAGAGCGACAAACTCGAAAATGGCCTGGCTCAGCCTTCTTTC
GCTTATTGTTTGCTTATCAGTCGCGGGTTTGCAAGTGTGGCACCTGAAGACATTTTTCGAGAAGAAGAAGGTTATATAA