Details for Pear Locus Pbr028310.1

Position : scaf_47.0 ( 5`- 321364 .. 330086 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr028310.1

Protein [Map View]
MAAGYNGTEVPILPNTLPQYSEDNDQLLFDTFVSQKRKASVSIPMSSMDSGTSYEGEHRLEGHTGPLGSQSKPLFGPVSG
PLYANGRPDSIFRAAEALTAGQEVVEPAGENFPSTNATNQNEWTDENYAGKNEHLLRSGRLGLCNDPYCTTCPTYNPKAA
HRRTSEIIDSKFYSALYGDAKGSARSFFSFLSPYIPGVMNPHAKVVQQWDRFFVISCIISIFVDPLFFFLLLVDQDKNCI
VLDWPLTTRLVIFRSITDFIYLMHILLQFRLAYVGPESRGVGAGDLVDHPKKIVLNYLQGYFLLDFFAIIILLVLPDNLG
LRGANYAKNLLRASVLVQYIPRLFRFLPLLAGQTPSGFIFESAGANFVINILIFVLASHVIGSCWYLMGLQRVNQCFRDA
CGISGINGCLSFIDCGRGNEFGDSGVDNPSRDSWINNANASACLTSSGYTYGVYYQTAALTTQKSIVTRYVYGLFWGFQT
LGTVAGNLVPSYFGWVVLFLIGCIALGVLIFALIVGNMQNLVQALDRRRLEISFRRHDVEQWMRNRRLPEELRRRVREAE
RYTYAATRGVNEEVLVGILPENIQIDIRRHLFKFIKKVRIFALMDEPILDSICGRLRQTTYMKGSKVLYRGGLIEKMVFI
VRGKMESIGEDGIRIPLSEGDVCGEELLTWCLEHSSVNKDAKRIRIPGQRLLSNRIVRCLTNVEAFSLRAADIQEVTSVF
SRFLRNPRVQGAVRYESPYWRGLAARYIQVAWRYRKKYLQQADSSQSQSHSQSQSQSQSQSQSRSQFNHALL*

DNA
ATGGCTGCTGGTTATAATGGAACTGAGGTACCCATCCTACCAAACACTCTTCCGCAATACTCAGAAGATAATGACCAGCT
ACTGTTCGACACATTTGTGTCCCAAAAGCGAAAGGCATCAGTTTCCATTCCCATGAGCTCTATGGACTCGGGCACGTCAT
ATGAAGGGGAACATAGACTTGAAGGTCATACTGGTCCATTAGGGAGCCAAAGCAAACCTCTTTTCGGACCTGTGAGTGGT
CCATTATATGCTAACGGCAGGCCTGATAGCATTTTCCGGGCAGCTGAAGCTCTAACAGCAGGGCAAGAAGTGGTGGAACC
TGCAGGAGAAAATTTTCCTTCTACCAATGCTACAAACCAGAACGAATGGACGGATGAAAACTATGCGGGTAAAAATGAAC
ACTTGCTGAGATCTGGCCGGCTGGGGCTGTGCAATGATCCTTACTGCACAACTTGCCCAACATACAATCCCAAGGCTGCT
CATCGAAGGACTTCAGAGATAATTGATTCCAAGTTTTATAGTGCTCTGTATGGGGATGCCAAAGGCAGTGCAAGGAGTTT
CTTTTCTTTTCTGAGTCCATATATACCTGGAGTTATGAACCCTCATGCTAAAGTTGTGCAACAATGGGACAGGTTTTTCG
TCATTTCTTGCATAATATCAATTTTTGTAGACCCACTGTTTTTCTTCCTGCTGCTCGTTGACCAGGATAAGAACTGTATA
GTTCTTGATTGGCCTTTGACGACAAGACTTGTGATTTTCAGAAGCATCACTGATTTCATATACCTAATGCACATACTCCT
TCAGTTTAGATTGGCTTATGTGGGTCCTGAGTCTAGGGGGGTTGGTGCTGGCGATTTAGTTGACCATCCGAAGAAAATCG
TTCTGAATTACCTTCAAGGATATTTTCTACTAGACTTTTTCGCTATCATAATACTGTTAGTTCTACCAGACAACTTGGGA
TTAAGAGGAGCAAATTATGCAAAAAATCTTTTACGTGCTTCAGTTCTTGTTCAGTATATTCCCAGGTTATTTAGGTTTCT
GCCTCTGCTCGCTGGTCAGACTCCAAGTGGCTTCATATTTGAGTCAGCAGGGGCAAATTTTGTAATAAATATTCTCATAT
TTGTGTTGGCTAGCCACGTTATTGGATCGTGCTGGTACCTCATGGGGCTACAGAGGGTTAATCAATGTTTTCGAGATGCC
TGCGGTATATCTGGAATTAATGGATGTCTGAGCTTCATAGATTGTGGGCGTGGAAACGAATTTGGAGATTCTGGAGTAGA
TAATCCATCACGTGATAGCTGGATAAACAATGCGAATGCTAGTGCGTGTTTAACTTCAAGTGGCTATACTTACGGAGTTT
ACTACCAAACCGCCGCTCTTACGACACAAAAGAGTATAGTCACTAGATATGTGTACGGATTGTTTTGGGGATTCCAGACA
CTCGGTACCGTGGCTGGAAATCTAGTTCCGAGCTATTTTGGTTGGGTAGTCCTTTTTTTAATTGGCTGCATTGCCCTAGG
TGTCTTGATTTTCGCTCTTATAGTTGGAAATATGCAGAACTTGGTGCAGGCTCTTGACCGGAGACGGTTAGAAATTTCCT
TCAGACGTCATGATGTTGAGCAGTGGATGAGGAATAGACGCTTGCCAGAGGAGCTTAGAAGGCGGGTGCGAGAAGCTGAG
CGGTACACTTATGCAGCAACCAGAGGAGTAAATGAAGAAGTGCTTGTGGGAATCCTGCCTGAAAACATTCAGATAGATAT
AAGACGTCATCTCTTCAAGTTTATTAAGAAAGTACGAATTTTTGCCCTGATGGATGAACCCATCTTAGATTCCATTTGTG
GAAGACTAAGGCAAACGACATACATGAAGGGAAGTAAAGTTTTGTACCGTGGTGGTCTCATCGAGAAGATGGTTTTTATA
GTGAGGGGAAAAATGGAGAGCATTGGAGAAGATGGGATTAGAATTCCGTTATCTGAAGGAGATGTTTGTGGTGAGGAACT
TCTCACATGGTGTCTTGAGCATTCTTCGGTAAACAAAGATGCTAAAAGGATCAGGATTCCTGGACAGCGGTTGCTTAGCA
ACAGGATTGTAAGATGCTTAACAAACGTTGAAGCATTTTCACTCCGAGCAGCTGACATTCAAGAAGTCACCAGTGTTTTC
TCCAGATTCTTGCGCAACCCGCGTGTTCAAGGAGCCGTAAGGTATGAGTCACCTTACTGGAGAGGCCTTGCAGCAAGATA
CATTCAAGTAGCATGGAGATACAGGAAAAAATACCTGCAGCAAGCAGACTCCTCTCAGTCTCAATCTCACTCTCAGTCTC
AATCTCAATCTCAATCTCAATCTCAATCTCGATCCCAATTCAATCATGCACTGTTATAA