Details for Pear Locus Pbr002924.1

Position : scaf_112.0 ( 5`- 464179 .. 464978 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr002924.1

Protein [Map View]
MASPFFQSERVDDPRIPGEKRKFGSGHGAGGIGDGSMIRGSRGKRGNSVVAMARVGLEAVGRERRGGGGKGSEAAATAYE
KLDAWMRESVVEIVQNLREAPLLVNVYGRSSTDGRPRLETEKRVEEENWDGLRRKWEAGVAPFPDGVIFVEELDDNDNGG
GEGNGKDDGGDAITKAWGLVVQGKGKESGPACYLLKTSKVNNGSGFGLGMGLGCTHFCLVPVSSFREKAQSQLKNCWLLQ
A*

DNA
ATGGCATCGCCCTTCTTCCAATCGGAGCGTGTCGATGATCCGCGGATCCCGGGGGAAAAGAGGAAATTCGGTAGTGGCCA
TGGCGCGGGTGGGATTGGAGACGGGTCGATGATCCGCGGATCCCGGGGGAAAAGAGGAAATTCGGTAGTGGCCATGGCGC
GGGTGGGCTTGGAGGCGGTGGGGCGGGAGCGGAGGGGCGGCGGTGGAAAAGGGAGCGAGGCTGCGGCGACGGCGTATGAG
AAGTTGGACGCGTGGATGAGGGAGTCGGTGGTGGAGATAGTCCAGAATCTCCGGGAGGCGCCGCTGTTGGTCAATGTGTA
CGGGAGGAGTAGTACGGACGGTAGGCCGAGGCTGGAGACGGAGAAGCGGGTGGAGGAGGAGAATTGGGACGGGCTCAGAC
GTAAATGGGAGGCGGGAGTGGCGCCGTTTCCCGACGGCGTTATCTTCGTCGAAGAACTGGACGACAATGATAACGGTGGC
GGTGAGGGTAACGGTAAAGATGACGGAGGGGATGCGATCACGAAGGCGTGGGGGTTAGTGGTGCAGGGGAAGGGGAAGGA
GAGTGGGCCCGCCTGTTACTTGTTGAAGACGAGTAAAGTGAATAACGGGTCGGGCTTCGGGCTCGGTATGGGCTTGGGCT
GCACCCATTTCTGTTTGGTTCCGGTGAGCAGTTTCAGGGAGAAGGCCCAATCGCAGCTGAAGAATTGTTGGTTGTTGCAG
GCCTAG