Details for Pear Locus Pbr002921.1

Position : scaf_112.0 ( 5`- 446242 .. 449468 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr002921.1

Protein [Map View]
MKPLLLLFAVVVLAPVLARSLNPSLNDDVLGLIVLKADIQDPKGKLASWSEVDSSPCNWVGVKCHPRSNRVIELSLDDFS
LSGHIGRGLLQLQALRKLSLSKNNLTGSLTPNFTHIDNLRVLDLSENSFSGGVPEELFRQCGSLRVISLAKNKFSGKIPE
SLGSCASLAAVNFSLNQFSGSVPAGVWSLSGLRSLDLSDNLLKGEIPKGIELNNLRGVNLARNRFTGQLPDGIGSCSLLR
SIDLSENSFSGNLPQTMQKLGLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFTGEVPSSIGNLEALKVLNFSANG
FTGSLPKSMAYCTNLLALDFSKNSMAGELPVWIFEAGADEVSLSDKKLSISKNINQSLSAGNALQNLQVLDLSLNHFSGE
IASDIGALSSLHTLNLSGNSLAGPLPVAIGELKVLNNLDLSENRLNGSIPQEIGGAFSLKELRLDKNFLTGKIPTSIEHC
SSLTTLTVSQNRLTGPLPASMSKLTNLQIVDLSFNNLTGGLPKQLANLPNLLSFNISHNNLQGELPTGAFFNTISPSSVS
GNPSLCGSAVNKSCPGVLPKPIVLNPNSSSDSTTGEISSNLGHRRILLSISSLIAIAAAAVIVIGVIAITVLNLRVRSPT
TQSAPALAFSGGDDFSRSPTTDGNSGKLVMFSGEPDFSTGAHALLNKDCELGRGGFGAVYRTLLQDGRPVAIKKLTVSSL
VKSQEEFEREVNKLGKVRHDNLVEIEGYYWTPSLQLIIYDYVAGGSLYKHLHDGAGGNFLSWNDRFNIILGTAKGLAHLH
QMNIIHYNIKSSNVLIGCSGEPKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGVLVLEIV
TGKRPVEYMEDDVVVLCDMVRGALEEGRVEECVDARLQGIFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILDLIRCP
SEGQEEL*

DNA
ATGAAACCGCTGCTCCTCCTCTTCGCCGTCGTCGTTTTGGCTCCGGTTCTCGCGAGATCTCTGAACCCGTCTCTAAACGA
TGACGTGTTGGGTCTGATAGTTCTTAAGGCCGATATCCAAGATCCGAAGGGGAAGTTAGCGTCCTGGAGCGAAGTCGACA
GCAGTCCTTGCAATTGGGTCGGGGTGAAATGCCACCCGAGATCCAACCGGGTCATTGAGCTCAGCCTCGACGACTTCTCG
CTTTCGGGTCACATCGGCCGAGGCCTTCTGCAATTGCAAGCTCTTCGGAAGCTCTCTCTTTCGAAGAACAATCTCACCGG
AAGCTTAACCCCTAACTTTACTCACATCGACAACCTCCGAGTCCTTGATTTGAGCGAGAACAGCTTCTCCGGTGGCGTTC
CTGAAGAGTTATTTCGGCAATGTGGGTCGCTGAGAGTGATTTCTCTGGCGAAAAACAAGTTTTCCGGGAAAATTCCGGAG
AGTTTGGGCTCTTGTGCGAGTCTAGCAGCTGTTAACTTTTCGTTGAACCAGTTTTCGGGTTCGGTTCCAGCTGGGGTTTG
GTCCTTGAGTGGGCTTAGATCCCTGGATTTGTCTGATAACTTGTTGAAGGGTGAAATTCCAAAGGGGATTGAATTGAATA
ATTTGCGAGGAGTTAATTTGGCCAGGAATCGGTTTACCGGGCAACTTCCGGATGGAATTGGAAGCTGTTCGCTCTTGAGG
TCCATTGATCTGAGTGAGAATTCGTTCTCGGGTAACCTCCCTCAGACAATGCAGAAACTTGGCCTGTGCAGCTATCTGAA
TCTGCACCAGAACACATTTTCTGGTGAGGTTCCGGAGTGGATTGGCGAGATGAAAAGCCTGGAGACTTTGGACCTTTCTA
GCAACCGGTTTACGGGTGAAGTTCCAAGCTCAATAGGCAATCTTGAGGCTTTGAAGGTATTGAATTTTTCTGCAAATGGG
TTCACTGGGAGCTTGCCAAAGTCTATGGCTTATTGCACGAACCTTCTGGCTCTAGATTTTAGTAAGAATTCGATGGCGGG
TGAACTTCCGGTGTGGATATTCGAGGCGGGTGCAGATGAAGTTTCACTTTCAGATAAAAAACTAAGCATAAGCAAGAACA
TCAATCAATCTTTATCAGCTGGAAATGCACTTCAGAATCTCCAAGTCTTGGATTTATCCCTGAATCATTTTTCGGGTGAA
ATTGCGTCCGACATTGGGGCCTTAAGCAGCTTGCATACTTTGAACCTTTCTGGTAACTCTCTTGCTGGTCCTCTTCCTGT
GGCTATTGGAGAGTTGAAGGTCCTGAACAATCTCGACTTGAGCGAGAATCGGCTCAATGGAAGCATCCCTCAGGAAATTG
GAGGGGCTTTTTCTTTGAAGGAATTGAGATTGGATAAGAACTTCCTCACGGGAAAAATTCCAACTTCAATTGAGCATTGT
TCTTCTCTGACCACTTTAACTGTATCACAGAACAGACTGACTGGTCCATTACCTGCATCAATGTCCAAACTTACCAACTT
ACAAATTGTGGACTTGTCTTTCAATAACCTCACGGGAGGCCTGCCGAAGCAGTTAGCCAATCTTCCCAACCTACTTTCCT
TCAACATTTCCCACAACAACCTCCAGGGTGAACTACCTACGGGTGCCTTTTTCAATACCATCTCCCCTTCCTCTGTCTCT
GGAAATCCATCTCTCTGTGGCTCTGCAGTTAATAAGTCTTGCCCGGGAGTCCTTCCCAAACCCATTGTCCTCAATCCCAA
TTCCTCTTCTGACTCCACCACAGGAGAAATCTCATCAAATCTTGGTCATAGAAGAATCTTACTCAGTATTTCTTCGCTTA
TTGCCATTGCTGCAGCTGCTGTCATTGTCATTGGTGTAATTGCCATTACTGTGCTTAATCTCCGTGTCCGATCTCCCACA
ACTCAATCGGCGCCAGCCCTCGCATTTTCAGGTGGGGATGACTTCAGCCGTTCCCCAACAACAGATGGCAACTCTGGCAA
GCTTGTCATGTTTTCAGGTGAGCCTGATTTCAGCACTGGTGCACATGCTCTGCTCAACAAGGACTGTGAGCTTGGTCGTG
GCGGGTTTGGAGCAGTCTACCGGACACTTCTTCAAGATGGACGGCCAGTTGCAATCAAGAAGCTCACTGTTTCTAGTCTT
GTCAAGTCTCAAGAAGAATTCGAAAGGGAAGTGAATAAATTGGGGAAAGTGAGGCACGATAATCTTGTGGAGATCGAAGG
CTATTACTGGACTCCATCATTACAGCTCATCATATACGATTATGTTGCCGGTGGTAGTTTATATAAGCATCTTCATGATG
GAGCAGGTGGAAACTTCCTGTCGTGGAATGATCGGTTCAATATAATTCTTGGAACTGCAAAAGGTTTGGCTCACTTGCAT
CAGATGAACATAATTCACTACAATATAAAGTCCAGTAATGTCCTGATTGGCTGCTCAGGCGAACCGAAAGTGGGAGACTT
TGGTCTAGCGAGGTTGTTGCCAATGCTTGACCGATATGTTTTGAGCAGCAAGATCCAGAGTGCACTCGGCTACATGGCAC
CTGAGTTTGCTTGCAAAACAGTAAAGATAACTGAGAAATGTGATGTGTACGGGTTTGGGGTTTTGGTTCTAGAGATTGTC
ACCGGGAAAAGACCAGTCGAGTACATGGAAGATGATGTTGTGGTGCTCTGTGACATGGTGAGAGGAGCACTGGAAGAAGG
CAGGGTAGAAGAATGCGTTGATGCTCGGCTCCAAGGAATTTTCCCAGCAGAAGAGGCTATACCTGTGATGAAACTAGGCT
TGATATGCACATCACAAGTGCCGTCGAACAGACCAGACATGGGGGAGGTTGTCAACATTTTGGATCTGATCCGATGTCCT
TCAGAAGGCCAAGAGGAGTTGTGA