Details for Pear Locus Pbr002913.1

Position : scaf_112.0 ( 5`- 390687 .. 393444 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr002913.1

Protein [Map View]
MGTNHKRLIEELLEGRKTAVELQSLLHKPFGDSGSAGGGFVEXXXXXXQKPFGDSGSAEELLMKIMKTFTESLSVLTASD
GHEDHQSAASGEVYQVKPEPSHVEHSHCGDRSSEGSGESPKTQAFKDRRGCYKRRKTSQSWKVISTKIEDGQAWRKYGQK
IILKASYPRAYFRCTRKYDQGCMATKQVQQIRDNPRTYQTTYIGEHTCRTMIKASPTIIGPDPRRSQTVSSESGSPHRQN
PNFFGSSSSSIPIVKQEDSKVGTPSDVTDNNVWLGLKDHFGLSEPAGICVSSNENVVSNMQWDDMDLVKSINFECDINFD
EAEFPITPCNDRF*

DNA
ATGGGAACCAACCACAAGAGACTGATCGAGGAGCTACTTGAAGGCCGGAAGACAGCGGTGGAGCTTCAGAGTCTGCTCCA
CAAGCCGTTCGGAGATAGTGGATCGGCGGGGGGGGGTTTTGTGGAANNNNNNNNNNNNNNNNNNCAAAAGCCGTTCGGAG
ATAGTGGATCGGCGGAGGAGCTTTTGATGAAGATCATGAAAACATTCACAGAGAGTCTCTCTGTTCTGACTGCTTCTGAC
GGCCATGAGGATCACCAGTCTGCTGCTTCCGGTGAGGTTTATCAGGTCAAGCCTGAACCTTCCCATGTGGAGCACTCGCA
TTGCGGTGACCGGAGCTCTGAAGGTTCCGGTGAGAGTCCAAAGACTCAGGCTTTCAAGGACCGGAGAGGTTGCTACAAGA
GGAGAAAGACATCTCAATCATGGAAAGTAATCTCTACCAAAATTGAAGATGGTCAGGCTTGGAGAAAATATGGCCAAAAG
ATAATCCTCAAAGCTTCATATCCAAGGGCTTACTTCAGATGCACAAGAAAGTATGATCAAGGTTGCATGGCAACCAAACA
GGTCCAACAAATCCGAGACAACCCACGCACTTACCAAACCACCTACATTGGCGAGCACACGTGCAGAACCATGATCAAGG
CTTCTCCAACGATCATCGGCCCTGATCCTAGGCGATCTCAGACTGTTAGCTCAGAATCTGGGTCCCCACATCGCCAAAAC
CCTAATTTCTTTGGCTCATCCTCGTCGTCCATTCCCATCGTCAAACAAGAAGATTCCAAAGTGGGGACACCAAGTGATGT
AACGGACAACAATGTGTGGCTTGGTTTGAAGGATCACTTTGGTTTATCCGAGCCTGCCGGAATCTGCGTGTCTTCCAATG
AGAATGTGGTTTCAAACATGCAGTGGGACGACATGGATTTGGTGAAGTCGATTAATTTTGAGTGTGATATTAATTTTGAT
GAAGCTGAGTTTCCTATAACTCCTTGTAATGATAGGTTTTGA