Details for Pear Locus Pbr002906.1

Position : scaf_112.0 ( 5`- 358080 .. 362314 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr002906.1

Protein [Map View]
MSPELTANVRLVRCPKCRQLLAELPDIPVYKCGGCGVTLQAKARVNGLRSKSASLNDTEAAQRIRLDHASEDKKSRSSAR
NATLSESGECSSDQENARDQKKSSEGSESSTSSTPKATYPESGNCFSNQNNEKDEDKPSEEEKSSSSSHNAAPGDQENER
DQKKSSEGNESSTSSTPKATYPESGNFFSNQNNEKNEDKPSEEKKSSSSSNNAALPEQNDEGDRGKSSEDNESSSPSTRE
LTFLEPGRYSSDQNNEKSEDKSSEVKESSISTQNASLSNPGEYFSDQNKEKSEDKSSEDEGSSTSGHNASLSKSGECASD
HNNETDNPVISKSSEGNESSSLSPKATVQGECFSDLNNEKEQIKSSEGNKFSSSSPKSTFPDSGECLLDQNNERDLSEPS
EGKQLSSSSPEATFPDSGKCFSEQDNKKSEIKSSDDKEFGSSNHGATLPDSGECTSDQTSMKGPNESSEDCDHEQAGDIN
LPNEDQNNQSDQNDSRDFDSEKLEVSNEFCSSTEFARDAVKETLPKTRKGAEVSTNDESSPLGETNVDVGINKEIDSDFQ
SSNTVNQGEVRGNSSIVAAHMAAREIISSDSFESSHNEQQVEPRNSVPNGFDVTAHMAVRESIAADSLTSSPNGQLKEPQ
NSAFSKGFDHVGSPDAFGNTEFFPSLELSGAPRDLSRSPANRSHHAYDASVSSYDGMDDQFFNRNTRSNIVHSEERIRRD
KFMANSMMTRDPGLQRQARDPWSNLPVKNDHAMKYRKWDQDALLPPRRQGHPSQDWNRLQSDEYMSRMAFRRRVSQGGYK
NRGLTNQLHNEYQHNSGYQSSEMSVEDKRTLLRMVYELQDQVNNLNGKASGRDARGATWKEKSMAQYRDYEASEEELYHD
PNYQRYLRRHMAGSHYPPEHHCKNMRIPFSSEATTSRHQADSSYLHYEPQDWQCSAPLPQPVRCCNNGLCRVHPGHSCWT
SYDESHPSTPEQYVESDFPLWGRETMSDDLRHQRHDVNKLYRQKQHLAKRHFRPIAGGAPIITCYNCSKLLQIPADFLLF
KRRYHRLRCGACLEVLRFSLRKRSHIVPYEQNAIAPPPSEVGDYNAAANGGNLAQHADTVSCSDDYGYGPSYYNGYSTDG
DPGALAPSNSPRGDSKNRNMSYTSLDQMKERKELVLRQSRNKDKNPIETFVPARPSLSSEIEELPAKSSSPLHKLMGYAS
PSQVIRGSRK*

DNA
ATGTCTCCTGAACTGACAGCAAATGTTCGACTTGTACGATGTCCGAAATGCCGGCAGCTTCTTGCCGAGTTGCCGGATAT
TCCGGTCTACAAGTGCGGCGGATGTGGTGTCACTCTCCAAGCAAAAGCTCGAGTAAATGGATTGAGAAGCAAGAGCGCTA
GCTTAAATGACACTGAGGCAGCTCAGAGGATTCGTTTGGATCACGCTTCTGAAGATAAAAAGTCCAGAAGTTCAGCTCGT
AATGCAACTCTTTCTGAATCCGGAGAATGCTCTTCAGACCAAGAGAATGCGAGGGATCAGAAGAAGTCGTCTGAAGGCAG
CGAGTCTAGCACCTCAAGTACTCCTAAGGCTACTTATCCTGAATCAGGAAATTGCTTTTCGAACCAAAACAATGAGAAGG
ATGAAGACAAGCCTTCCGAAGAAGAGAAATCTAGCAGCTCGAGCCATAATGCAGCTCCTGGAGACCAAGAGAATGAGAGG
GATCAGAAGAAGTCGTCAGAAGGCAACGAGTCTAGCACCTCAAGTACTCCTAAGGCTACTTATCCTGAATCAGGAAATTT
CTTTTCGAACCAAAACAATGAGAAGAATGAAGACAAGCCTTCCGAAGAAAAGAAATCTAGCAGCTCGAGTAATAATGCAG
CTCTTCCAGAACAAAACGACGAGGGGGATCGGGGTAAATCTTCAGAAGACAACGAATCTAGCAGCCCAAGTACTCGTGAG
CTTACTTTTCTTGAGCCAGGAAGATACTCTTCGGACCAAAACAACGAGAAGAGTGAAGATAAGTCTTCTGAAGTCAAAGA
ATCTAGCATCTCAACTCAAAATGCAAGTCTTTCAAACCCAGGAGAATACTTTTCGGACCAAAACAAGGAGAAGAGTGAAG
ATAAGTCTTCCGAAGACGAAGGATCTAGCACCTCAGGTCATAATGCAAGTCTTTCAAAGTCAGGAGAATGCGCTTCAGAT
CACAACAATGAGACAGATAATCCTGTCATTAGTAAATCTTCAGAAGGTAATGAATCCAGCAGCTTAAGTCCTAAGGCTAC
TGTTCAAGGAGAATGTTTCTCGGACCTAAACAATGAGAAGGAGCAGATTAAGTCTTCAGAAGGCAACAAATTTAGCAGCT
CAAGTCCAAAATCTACTTTTCCTGACTCGGGAGAATGTTTACTGGACCAAAACAATGAGAGGGATCTAAGTGAACCTTCA
GAAGGCAAGCAGCTTAGCAGCTCAAGTCCTGAGGCAACTTTTCCTGACTCGGGAAAATGCTTCTCAGAACAAGACAATAA
GAAGAGTGAAATCAAGTCTTCTGATGACAAGGAATTTGGCAGCTCAAATCATGGCGCTACTCTTCCAGACTCAGGAGAGT
GCACTTCAGATCAAACCAGTATGAAGGGTCCCAATGAGTCTTCTGAAGATTGTGATCATGAACAAGCTGGAGATATAAAC
TTACCAAATGAAGACCAAAATAATCAGAGTGATCAAAATGATTCTCGTGATTTTGATAGTGAGAAACTTGAAGTTTCCAA
TGAATTTTGTTCATCGACTGAGTTTGCACGTGACGCAGTTAAGGAGACATTACCAAAAACACGAAAAGGTGCAGAAGTAT
CAACGAATGATGAGAGCTCACCTTTAGGAGAAACAAATGTGGACGTAGGCATCAACAAGGAGATTGATTCTGATTTCCAG
AGCTCAAATACTGTAAATCAGGGAGAAGTGAGGGGAAATAGTTCAATTGTTGCTGCTCATATGGCCGCACGGGAAATCAT
TTCATCAGATTCCTTTGAATCTTCTCACAATGAACAACAGGTGGAACCTCGGAATAGTGTTCCTAATGGCTTTGATGTTA
CTGCTCATATGGCGGTAAGGGAAAGCATTGCGGCGGATTCCCTGACATCTTCTCCTAATGGGCAACTGAAGGAACCTCAG
AATAGTGCTTTTTCCAAAGGCTTTGATCATGTAGGGTCTCCTGATGCATTTGGAAATACGGAGTTCTTCCCCAGCCTTGA
GCTTAGCGGTGCACCTAGAGATCTGTCGAGGTCCCCAGCAAATAGAAGTCATCATGCTTATGATGCCAGTGTTTCTTCTT
ATGATGGCATGGATGATCAGTTCTTCAACCGAAATACACGTTCAAACATTGTTCATTCTGAAGAAAGAATCCGAAGGGAT
AAATTCATGGCGAATAGCATGATGACTAGAGATCCAGGATTGCAACGTCAAGCAAGGGATCCCTGGTCAAATTTGCCTGT
GAAGAATGATCATGCGATGAAATACAGAAAGTGGGATCAAGATGCATTACTGCCACCTAGAAGACAAGGCCATCCAAGCC
AAGATTGGAATAGATTGCAGAGTGATGAATATATGTCTAGGATGGCATTCCGTCGAAGAGTTTCCCAAGGCGGATACAAA
AATAGAGGCCTTACAAATCAACTGCATAACGAGTACCAGCACAATTCAGGCTACCAATCATCTGAAATGTCTGTGGAGGA
CAAGAGGACACTATTGAGAATGGTTTATGAACTGCAGGACCAAGTTAACAATTTGAATGGAAAGGCGAGTGGAAGGGATG
CGAGAGGAGCCACTTGGAAGGAGAAGAGCATGGCCCAGTACCGTGATTATGAGGCATCCGAGGAGGAACTCTATCATGAT
CCAAACTATCAGAGGTATCTGAGAAGACACATGGCAGGCAGCCACTATCCCCCCGAACACCACTGTAAAAACATGCGTAT
ACCTTTCTCAAGTGAGGCAACAACCAGCAGGCACCAAGCTGATTCTTCATATTTGCACTATGAACCCCAAGACTGGCAGT
GCTCAGCACCTTTGCCTCAACCCGTTCGTTGCTGCAACAATGGGTTATGTAGGGTTCACCCTGGTCACAGTTGCTGGACA
TCCTATGACGAGTCTCATCCTTCAACCCCCGAACAGTATGTGGAATCTGATTTTCCTCTTTGGGGCCGTGAAACAATGTC
TGATGATCTGAGGCACCAAAGGCATGATGTGAATAAGCTTTACAGACAGAAACAACATTTGGCTAAGCGACATTTCCGAC
CCATAGCAGGTGGAGCCCCTATCATAACTTGTTACAACTGCTCAAAACTACTGCAGATACCTGCAGATTTTCTCCTTTTC
AAAAGGAGATACCATAGACTTCGATGTGGGGCTTGCTTGGAGGTGCTCAGATTTTCGCTCCGAAAGAGATCGCATATTGT
CCCCTATGAACAGAATGCTATAGCCCCTCCTCCGAGTGAGGTTGGCGACTATAATGCTGCCGCTAATGGCGGTAACTTGG
CTCAACATGCAGATACCGTTTCATGTTCGGATGATTATGGTTACGGACCCTCTTACTACAACGGTTACTCTACTGACGGT
GATCCAGGAGCTCTCGCACCCTCCAACTCTCCCCGAGGCGATTCAAAAAACCGGAATATGTCATATACTTCATTGGATCA
AATGAAAGAGAGGAAGGAGCTTGTTTTGAGACAGTCTCGGAACAAAGATAAGAATCCAATTGAAACATTTGTGCCAGCAA
GACCGTCGTTATCCTCAGAAATCGAGGAGCTGCCAGCAAAGTCGAGTTCACCACTTCATAAACTCATGGGCTATGCTTCG
CCAAGCCAGGTGATTAGAGGGTCAAGGAAGTAA