Details for Pear Locus Pbr002902.1

Position : scaf_112.0 ( 5`- 334944 .. 335862 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr002902.1

Protein [Map View]
MGSCCSVVSFFICTQGSFKTIRDNWPFSAFHLRKCFDFLQCTGYNVDEVHQEGHHLAGGNVHLIKTMDSWEEKLSEAIKD
GKIVVANFSASWCRPCLVIAPAYCELADKYPSIVFLTVDVDVLAELSTSWDIKATPTFVFLKDGRQVDKLIGGNKPELQK
KTAAVVAQLATKSPS*

DNA
ATGGGAAGCTGCTGCTCTGTGGTAAGTTTCTTTATATGCACACAAGGATCATTTAAAACCATCCGAGATAATTGGCCTTT
TTCCGCATTCCATCTGAGGAAATGCTTCGATTTCTTGCAGTGTACCGGATATAATGTCGATGAGGTTCATCAAGAGGGTC
ATCATCTTGCCGGTGGAAATGTGCACCTTATAAAGACCATGGACAGTTGGGAGGAAAAGTTGTCAGAAGCAATCAAGGAT
GGAAAGATCGTTGTTGCAAATTTCAGTGCATCTTGGTGTAGGCCTTGTCTTGTAATTGCACCAGCCTACTGTGAGCTTGC
AGATAAATATCCTTCTATCGTATTTCTAACCGTGGATGTTGACGTTCTCGCTGAGTTGAGCACTTCATGGGATATAAAGG
CCACTCCGACCTTCGTTTTTCTTAAAGATGGAAGACAAGTGGACAAACTCATCGGAGGAAACAAGCCGGAGCTCCAGAAG
AAGACAGCAGCAGTCGTGGCTCAGTTAGCAACCAAGTCTCCTAGTTGA