Details for Pear Locus Pbr002900.1

Position : scaf_112.0 ( 5`- 324942 .. 327245 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr002900.1

Protein [Map View]
MSKPSSRIFQGLLRFHRSQISKPSSPSPPPLSSARRSYHSSNGPPPQFPSHPKTVPGGGVGRYSGPGVGLGMRFFSFKPS
NFSKIDAKKVFDKPLSAASSAFSRYQEAIGLQIEAFWKRNNLVLLGIGGLLVCALLWRMMFGIASTFIGLSEGMAKYGFL
ALSTAIVAFAGLYIRSRFTINPDKVYRIAMRKLNTSAGILEVMGAPLSGSELRAYVMSGGGVTLKKFKPTFRSKRCFLIF
PVRGSERKGLVNVEVKKKKGQYDMKLLAVDIPMASGPDQRLFLIGDEEEYKVGGGLIAELRDPVVRAMAATEEFDNLDQI
EEEEDAEKALEEAEKKHREEIEKLEKSGSQ*

DNA
ATGTCAAAACCCTCGTCTCGGATCTTCCAAGGCCTGCTAAGATTTCACCGCAGCCAAATCTCAAAACCCTCATCTCCGTC
TCCGCCTCCGTTGTCCTCCGCCAGGAGGAGCTACCACTCCAGCAATGGGCCTCCTCCCCAATTTCCCTCTCACCCGAAAA
CAGTCCCCGGAGGTGGGGTTGGCAGATACTCCGGGCCGGGTGTGGGCCTGGGCATGAGGTTTTTCTCTTTCAAGCCGTCG
AATTTCAGCAAAATCGATGCTAAGAAGGTGTTTGATAAGCCGCTCTCCGCGGCGTCATCGGCTTTCTCGCGGTACCAGGA
GGCCATTGGGTTGCAGATTGAGGCGTTCTGGAAGAGGAACAATCTGGTGCTGTTGGGAATTGGGGGACTGCTGGTGTGTG
CTTTGCTATGGAGGATGATGTTTGGGATTGCTAGCACCTTCATTGGACTCTCTGAAGGCATGGCCAAGTATGGCTTCCTC
GCCCTTTCTACCGCCATTGTCGCCTTCGCTGGCCTTTACATCCGCTCGAGGTTCACAATCAATCCTGATAAAGTTTATCG
AATCGCAATGAGGAAGCTTAATACATCTGCTGGGATTCTCGAGGTTATGGGTGCTCCTCTCTCTGGATCAGAGCTAAGAG
CTTACGTAATGTCCGGAGGTGGAGTTACTCTGAAGAAGTTCAAGCCAACTTTTAGGAGCAAGCGGTGCTTCCTCATTTTC
CCTGTGCGAGGTTCTGAGAGGAAGGGCCTGGTTAATGTTGAAGTAAAGAAGAAAAAAGGCCAGTATGACATGAAGCTACT
GGCAGTTGACATTCCCATGGCATCAGGACCTGACCAGCGCTTGTTCCTGATTGGCGATGAAGAAGAGTACAAAGTCGGTG
GCGGACTAATAGCTGAACTTAGGGATCCGGTTGTGAGAGCAATGGCTGCAACCGAGGAGTTCGATAATCTTGATCAGATT
GAAGAAGAGGAGGATGCTGAAAAAGCACTTGAGGAGGCAGAAAAAAAGCATCGCGAAGAAATTGAAAAGCTTGAAAAGAG
CGGGTCACAGTGA