Details for Pear Locus Pbr001434.1

Position : scaf_103.0 ( 5`- 928757 .. 930086 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr001434.1

Protein [Map View]
MASLGVQFGGNNNAVLDHRRQNSLCICSPSSKQSVSMIRGCGGKRGSEVLAMAGAGLEAVGRERRRGGGSDAAAAAYEKL
DEWMRESVVEIVKNLREAPLLVNVYGRSTDGRPRLETEKRGGGGNWDGLRREWAAGVAPFPDGVIFVEELDDDNGDGEGS
GNNEGGDAITRAWGVVVQGRGEESAPACYLLKTSKVDSGPGFGLGMGLGCTHFCLVRVSSFREKAQSQLKNCWLLQAQAQ
*

DNA
ATGGCGTCGCTGGGAGTCCAGTTCGGAGGGAATAACAACGCCGTTCTTGATCACCGCCGTCAGAACAGTCTTTGCATCTG
CAGTCCTTCTTCCAAACAGAGTGTTTCGATGATACGTGGATGCGGGGGCAAAAGAGGAAGTGAGGTACTGGCGATGGCGG
GGGCGGGATTGGAGGCGGTGGGGCGGGAACGGCGACGAGGCGGTGGGAGCGACGCGGCAGCGGCGGCGTATGAGAAGTTG
GACGAGTGGATGAGGGAGTCGGTTGTGGAGATTGTCAAGAATCTCCGGGAAGCACCGCTGTTGGTTAACGTGTACGGGAG
AAGCACGGACGGGAGGCCGAGGCTGGAGACGGAGAAGCGGGGGGGGGGGGGGAATTGGGACGGGCTCAGACGGGAATGGG
CGGCGGGAGTGGCGCCGTTCCCGGACGGCGTTATCTTTGTGGAAGAATTAGATGATGATAACGGTGACGGAGAGGGCAGC
GGTAACAATGAGGGAGGGGATGCGATCACGAGGGCGTGGGGGGTCGTGGTGCAGGGGAGGGGGGAGGAGAGTGCGCCCGC
CTGTTACTTGTTGAAGACGAGTAAAGTGGATAGCGGGCCGGGGTTCGGGCTGGGAATGGGTTTGGGTTGCACTCATTTCT
GTTTGGTTCGGGTCAGCAGTTTCAGGGAGAAGGCCCAGTCGCAGCTCAAGAATTGTTGGTTATTGCAGGCCCAGGCCCAG
TGA