Details for Pear Locus Pbr001431.1

Position : scaf_103.0 ( 5`- 912094 .. 915207 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr001431.1

Protein [Map View]
MRPFSGMKTLLLLFAVVVLCPVLARSLNPSLNDDVLGLIVFKANIQDPKGKLASWSEDDDSACSWVGIKCHPRSNRVIEL
NLDDFSLSGHIGRGLLQLQALRKLSLSKNNLIGSLTPNIAHIDNLRVLDLSENSFSGDVPEEFFRQCGSLRVISLAKNKF
SGKLPESLGSCPSLASVNLSLNQFSGSVPAGVWSLSGIRSLDLSDNLLEGGIPKGVEGLNNLRGINLARNRFTGQVPDGI
GNWLLLRSIDLSENSFSGNLPQTMQKLGLCSYLNLHQNTFSGEVPEWIGEMKSLETLDLSSNRFSGEVPSSIGNLESLKV
LNFSANGFTGSLPKSLSYCTNLLGLDFSKNSMAGELPVWIFAAGTEEVSLSEKKPSGSKNIPLSSSAGNALKNLQVLDLS
LNHFSGEITSDIGALSSLHVLNLSGNSLAGPIPVAIGDLKVLDNLDLSENRLNGTIPTSIENCSSLTTLIVSQNRLTGPI
PAAMSKLTNLQNVDLSFNSLTGGLPKQLANLPNLLSFKISHNNLQGELPAGAFFNTISPSSVSGNPSLCGSAVNKSCPGV
LPKPIVLNPNSSSDSSTGEISSNLGHRRILLSISSLIAIAAAAVIVIGVIAITVLNLRVRSSSSTTQPAAALAFSGGDDF
SHSPTTDGNSGKLVMFSGEPDFSTSAHALLNKDCELGRGGFGAVYRTVLRDGRPVAIKKLTVSSLVKSQGEFEREVKKLG
KVRHDNLVEIEGYYWTPSLQLIIYEYVAGGSLYKHLHDGAGGNFLSWNDRFNIILGTAKSLAHLHQMNIIHYNIKSSNVL
IGSSGEPKVGDFGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVKITEKCDVYGFGILVLEIVTGKRPVEYMEDDVVV
LCDMVREALEEGRVEECVDARLQGIFPAEEAIPVMKLGLICTSQVPSNRPDMGEVVNILELIRCPSEGQEEL*

DNA
ATGCGACCCTTTTCAGGCATGAAAACGCTGCTCCTCCTATTCGCCGTCGTTGTTTTGTGTCCGGTTCTTGCGAGATCTCT
GAACCCGTCTCTGAACGACGACGTGTTGGGGCTGATAGTGTTCAAGGCGAATATCCAAGATCCGAAGGGAAAGTTAGCGT
CTTGGAGCGAAGACGACGACAGTGCTTGCAGTTGGGTCGGGATAAAATGCCACCCGAGATCCAACCGGGTCATCGAGCTC
AACCTCGACGACTTCTCGCTTTCGGGTCACATCGGGCGCGGCCTTCTGCAACTTCAAGCGCTCCGGAAGCTCTCGCTTTC
GAAGAACAATCTCATCGGAAGCTTAACGCCTAACATTGCTCACATCGACAACCTCCGAGTTCTCGATTTGAGTGAGAACA
GTTTCTCCGGTGATGTTCCAGAAGAGTTTTTCCGGCAATGTGGGTCACTGAGAGTGATTTCTCTGGCGAAAAACAAGTTT
TCCGGGAAACTTCCGGAGAGTTTGGGCTCGTGTCCGAGTCTAGCTTCTGTTAACTTGTCGTTGAACCAGTTTTCGGGTTC
GGTTCCGGCTGGGGTTTGGTCCTTGAGTGGGATTAGATCACTGGATTTGTCTGATAACTTGTTGGAGGGTGGAATTCCAA
AGGGGGTTGAAGGATTGAATAATTTACGAGGAATTAATTTGGCCAGGAATCGGTTTACTGGGCAAGTTCCAGATGGAATT
GGAAACTGGTTGCTCTTGAGGTCCATTGATCTCAGCGAGAATTCGTTCTCGGGTAACCTCCCTCAGACAATGCAGAAACT
TGGCCTGTGCAGCTATCTGAATTTGCACCAGAACACATTTTCCGGTGAGGTTCCGGAGTGGATTGGAGAGATGAAGAGCC
TGGAGACTTTGGACCTTTCTAGCAACCGATTTTCGGGTGAAGTTCCAAGCTCAATAGGCAATCTTGAGTCTTTGAAAGTA
TTGAATTTTTCTGCAAATGGGTTCACTGGTAGCTTGCCAAAGTCTCTGTCTTATTGCACAAACCTTCTGGGTTTAGATTT
TAGCAAGAATTCGATGGCGGGTGAGCTTCCTGTGTGGATATTCGCGGCAGGTACAGAGGAAGTTTCACTTTCAGAGAAAA
AACCAAGTGGAAGCAAGAACATCCCTCTATCTTCATCAGCTGGAAATGCACTAAAGAATCTCCAAGTCTTGGATTTATCC
CTTAATCATTTTTCGGGTGAAATTACGTCTGACATTGGGGCCTTAAGCAGCTTGCACGTTTTGAACCTCTCTGGTAACTC
TCTTGCTGGTCCTATTCCTGTGGCCATTGGAGACTTGAAGGTCCTGGACAATCTCGACTTGAGCGAGAATCGGCTCAATG
GAACCATTCCAACTTCAATCGAGAACTGTTCTTCTCTAACCACTTTAATTGTATCACAGAACAGACTGACTGGTCCAATA
CCTGCGGCAATGTCCAAACTTACCAACTTACAAAATGTGGACTTGTCTTTCAATAGCCTCACAGGAGGACTGCCGAAGCA
GTTAGCCAATCTTCCCAACCTTCTTTCCTTCAAAATTTCCCACAACAACCTCCAGGGTGAACTACCTGCGGGTGCCTTTT
TCAACACCATCTCCCCTTCCTCCGTCTCTGGAAATCCATCTCTCTGTGGTTCTGCAGTTAACAAGTCTTGCCCGGGAGTC
CTTCCCAAACCCATTGTCCTCAATCCCAATTCCTCTTCTGACTCCAGCACAGGAGAAATCTCATCAAATCTTGGTCATCG
AAGAATCTTACTCAGTATTTCTTCGCTTATTGCCATTGCTGCAGCCGCTGTCATTGTCATTGGTGTAATTGCCATTACTG
TGCTTAATCTCCGTGTCCGGTCTTCCTCTTCCACAACTCAACCGGCGGCAGCCCTCGCATTTTCAGGTGGGGATGACTTC
AGCCATTCCCCTACAACAGATGGAAACTCTGGCAAGCTTGTCATGTTCTCAGGTGAGCCTGACTTCAGCACCAGCGCACA
TGCACTGCTCAACAAGGACTGTGAGCTTGGGCGAGGTGGGTTTGGAGCAGTCTACCGGACTGTTCTTCGAGATGGACGAC
CAGTTGCAATCAAGAAGCTCACTGTTTCTAGTCTTGTCAAATCTCAAGGAGAATTTGAAAGGGAAGTGAAGAAATTGGGG
AAAGTGAGGCACGATAATCTTGTGGAGATCGAAGGCTATTACTGGACTCCATCATTACAGCTCATCATATACGAATATGT
TGCCGGTGGTAGTTTATACAAGCATCTTCATGATGGAGCAGGTGGAAACTTCCTGTCGTGGAATGACCGGTTCAACATAA
TTCTTGGAACTGCAAAAAGTTTGGCTCATTTGCACCAGATGAACATAATTCACTACAATATAAAGTCCAGCAATGTCCTG
ATTGGCAGCTCAGGCGAACCCAAAGTGGGAGACTTTGGCCTGGCTAGGTTGTTGCCAATGCTTGACCGATATGTTCTGAG
TAGCAAGATTCAGAGCGCCCTTGGCTACATGGCACCAGAGTTTGCTTGCAAAACGGTAAAGATAACCGAGAAATGTGATG
TGTACGGGTTTGGGATTTTGGTTCTAGAGATTGTCACCGGGAAAAGACCTGTCGAGTACATGGAAGATGATGTTGTGGTG
CTTTGTGACATGGTGAGAGAAGCACTGGAAGAAGGCAGGGTAGAAGAATGTGTTGATGCTCGGCTCCAAGGAATTTTCCC
AGCAGAAGAGGCTATACCTGTGATGAAACTAGGCTTGATATGCACGTCACAAGTGCCATCAAACAGACCAGACATGGGGG
AGGTCGTCAACATTTTGGAGCTGATCCGATGTCCTTCCGAAGGCCAAGAGGAGTTGTGA