Details for Pear Locus Pbr001416.1

Position : scaf_103.0 ( 5`- 835360 .. 839387 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr001416.1

Protein [Map View]
MSPELTTKVRLVRCPKCRLLLAELPEIPVYKCGGCGVTLQAKSRINGLQCNATLPESGECSSDQDNERDQSKSSEGNESS
TSSTPKAAYPESGNCFSKQNNEKNEDKPSEEQKSSISSQNAALPYQNNERHESKSSEGNESISSSTRTVTFVDSEKSFSD
QNNEKRKDAAFEDKESSISTHNASLSNPGESLSDQNNEKSEDKSSEDKELSSSSNNASLLMSGESSSDQNNERGQSKSSE
GYESSSLSPEATFPGECLSDNQNNEKDQIKSSEGNRFSSSSPKATYLDLGECLPDQNNESNMVESSEGNKFSSSSPEATF
PDSGKCFSEQDNNKSEIKSSEYQEFGSSSHGATLQDSGECTSDQTSMKDPDKSSENCDCEQVGDINLPNEDQYNQSDRND
SRDFDSEQLEVSNEFCSLTEFAHDEVKETLPETRKGAEVLTNDGSSPLGETNVEVDINKEIDSDFQNSNTVNPGDARGSS
SIVTAHTAVRESISSDSFESSPNGRQEEPQNSVPNGFDHVRSPDAFENIVTAHMPEKESVSLDSLTSSPNGQQVEPQNSV
PIGFDHVRSPDAFEKRVTVHMPARESVSLDSLTSSPDGQLEEPQNSAFSNGFDHVRSPDVFENTEFFPSIDRSGAPRDLS
KSPANRSHHAYDASVSSYDGMDDQYLNRTARSNIFHSEERTRWDKFMASSMMNKDSGLQHQPRDPWSNLPMKNDRAMRYR
KRDQDASLPPRRQGHPSRDWNRLQSDESMYRMAFPRRVSQGGYENGGPTSQLHNEYQHNSGYQSSEMSVEAEQDKMTLLR
MVYELQDQVNSLNGKASGRVAGGATWKEKNMPQYRSYEAFEKELYHDPNYQRYPRRHRPGSLYPPQHHRKNMRIPFSSQA
TTSRHQPDSSYLHYGPQDWQCSAPLSQPVRCSNNRLCRVHPGHSCWTSYDKSRPSTPERYMGTPERYMGSDSPLWGHETM
SDDLRHQRHDAKKLYRETQRLAKRHFRPIAGGAPIITCYNCSELLQIPADFLLFKRRYHRLRCGACSEVLKFSLQKRAHI
VPYEQNAIAPLSEVGDYNAAANGSNLAHHADPVSCSDDYGYGPSYYHSYSSDGDPGAFAPSNSPQGDSEDQNMSHNSLDP
MRERKKLALREPQNKDKNPIVTFVSARPSLSSEIEELPAKSSSPLHRLMGYASPSLVIRGSGTSRTGRSSYPLHR*

DNA
ATGTCTCCTGAATTGACAACAAAAGTTCGACTGGTTCGATGTCCGAAATGCCGGCTGCTTCTTGCGGAGTTGCCCGAAAT
TCCGGTCTACAAGTGTGGCGGATGTGGCGTCACTCTCCAAGCGAAAAGTCGAATAAATGGATTGCAATGCAATGCAACTC
TTCCTGAATCTGGAGAATGCTCTTCAGACCAAGACAATGAGAGGGATCAGAGTAAGTCTTCCGAAGGCAACGAGTCTAGC
ACCTCAAGTACTCCTAAGGCTGCTTATCCTGAATCAGGAAATTGCTTTTCGAAACAAAACAACGAGAAGAATGAAGACAA
GCCTTCCGAAGAACAGAAATCTAGCATCTCAAGTCAGAATGCAGCTCTTCCATACCAAAACAATGAGAGGCATGAGAGTA
AATCTTCAGAAGGCAACGAATCTATCAGCTCAAGTACTCGTACAGTTACTTTTGTTGACTCAGAGAAAAGCTTTTCGGAC
CAAAACAACGAGAAGAGAAAAGATGCGGCTTTCGAGGACAAAGAGTCTAGCATCTCAACTCATAATGCAAGTCTCTCGAA
CCCAGGAGAGTCCCTTTCAGACCAAAACAATGAGAAGAGTGAAGATAAGTCTTCCGAAGACAAAGAATTGAGCTCTTCAA
GTAATAATGCAAGTCTTTTGATGTCAGGAGAATCCTCTTCAGACCAAAACAATGAGAGGGGCCAGAGTAAATCTTCGGAA
GGTTATGAATCTAGCAGCCTAAGTCCTGAGGCTACTTTTCCAGGAGAATGTTTATCGGACAACCAAAACAATGAGAAGGA
TCAGATTAAGTCTTCAGAAGGCAACAGATTTAGCAGTTCAAGTCCAAAAGCTACTTATCTTGATTTGGGAGAATGTCTAC
CGGACCAAAACAACGAGAGCAATATGGTTGAGTCTTCAGAAGGCAACAAGTTTAGCAGCTCAAGTCCTGAGGCAACTTTT
CCTGACTCGGGAAAATGCTTCTCAGAACAAGACAATAACAAGAGTGAAATCAAGTCTTCTGAATACCAAGAATTTGGCAG
CTCAAGTCATGGGGCTACTCTTCAAGATTCAGGAGAGTGCACTTCAGATCAAACCAGTATGAAGGATCCTGATAAGTCTT
CTGAAAATTGTGATTGTGAACAAGTTGGAGATATAAACTTACCAAATGAAGACCAATATAATCAGAGTGATCGAAATGAT
TCTCGTGATTTTGATAGTGAGCAACTTGAAGTTTCCAATGAATTTTGTTCATTGACTGAGTTTGCACATGATGAAGTTAA
GGAGACATTACCAGAAACACGAAAAGGTGCAGAAGTATTAACAAATGATGGGAGCTCACCTTTAGGAGAAACAAATGTGG
AGGTAGACATCAACAAGGAGATTGATTCTGATTTCCAGAACTCAAATACTGTAAATCCAGGAGATGCGAGGGGAAGTAGT
TCAATTGTTACTGCTCATACAGCCGTACGGGAAAGCATTTCATCGGATTCCTTTGAATCTTCTCCTAATGGACGACAGGA
GGAACCTCAGAATAGTGTTCCCAATGGCTTTGATCATGTAAGGTCTCCTGATGCATTTGAAAATATAGTTACTGCTCATA
TGCCGGAAAAGGAAAGCGTTTCATTGGATTCCCTGACATCTTCTCCTAATGGACAACAGGTGGAACCTCAGAACAGTGTT
CCCATTGGCTTTGATCACGTAAGGTCTCCTGATGCATTTGAAAAGAGAGTTACTGTTCATATGCCGGCAAGGGAAAGCGT
TTCATTGGATTCCCTGACATCTTCTCCTGATGGACAACTGGAGGAACCTCAGAATAGTGCTTTTTCCAATGGCTTTGATC
ATGTAAGGTCTCCTGATGTATTTGAAAATACGGAGTTCTTCCCCAGCATTGATCGTAGCGGTGCACCAAGAGATCTGTCA
AAGTCCCCAGCAAATAGAAGTCATCATGCTTATGATGCCAGTGTTTCTTCTTATGATGGCATGGATGATCAGTACCTCAA
CCGAACTGCACGTTCAAATATTTTTCATTCTGAAGAACGAACCAGATGGGATAAATTCATGGCAAGTAGCATGATGAATA
AAGATTCAGGATTGCAACATCAACCAAGGGATCCCTGGTCAAATTTGCCCATGAAGAATGATCGTGCCATGAGATACAGA
AAGCGGGATCAAGATGCATCACTGCCGCCTAGAAGACAAGGTCATCCAAGCAGAGATTGGAACAGATTGCAAAGTGATGA
ATCTATGTATAGGATGGCTTTCCCTCGAAGAGTTTCCCAAGGTGGATACGAAAATGGAGGCCCTACAAGTCAACTCCATA
ATGAGTACCAGCACAATTCAGGCTACCAATCATCTGAAATGTCTGTGGAGGCTGAACAGGACAAGATGACACTATTGAGA
ATGGTTTATGAACTGCAGGATCAAGTTAACAGTTTGAATGGAAAGGCGAGTGGAAGGGTTGCCGGAGGAGCCACTTGGAA
GGAGAAGAACATGCCCCAGTACCGTAGCTATGAGGCATTCGAGAAGGAACTCTATCATGATCCAAACTATCAGAGGTATC
CGAGAAGACACAGGCCAGGCAGCCTCTATCCCCCCCAGCACCACCGCAAAAACATGCGCATACCTTTCTCGAGTCAGGCA
ACAACCAGCAGGCACCAACCTGATTCTTCATATTTGCATTATGGCCCCCAAGACTGGCAGTGCTCAGCACCATTGTCTCA
ACCCGTTCGTTGCAGCAACAACAGGTTATGTAGGGTTCACCCTGGTCACAGTTGCTGGACATCCTATGACAAGTCTCGTC
CTTCAACTCCTGAACGGTATATGGGAACTCCTGAACGGTATATGGGATCTGATTCTCCTCTTTGGGGCCATGAAACAATG
TCTGATGATCTGAGGCACCAAAGGCATGATGCGAAGAAGCTTTACAGAGAGACACAACGTTTGGCTAAACGACATTTCCG
CCCCATAGCAGGTGGAGCCCCAATCATAACTTGTTACAACTGCTCAGAACTGCTGCAGATACCTGCAGATTTTCTCCTTT
TCAAAAGGAGATACCATAGACTTCGATGTGGGGCTTGTTCGGAGGTGCTCAAGTTTTCGCTCCAAAAGAGAGCTCATATT
GTCCCCTACGAACAGAATGCTATAGCCCCTCTGAGTGAAGTTGGCGACTATAATGCTGCCGCTAATGGCAGTAACTTGGC
TCACCATGCGGATCCTGTTTCATGCTCTGATGATTATGGTTATGGACCCTCTTACTACCATAGTTACTCTTCTGACGGTG
ATCCTGGAGCTTTTGCACCCTCCAACTCTCCCCAAGGTGATTCAGAGGACCAAAATATGTCACATAATTCATTGGATCCA
ATGAGAGAGAGGAAGAAGCTTGCTTTGAGAGAGCCTCAGAACAAAGATAAGAATCCAATTGTAACATTTGTGTCAGCAAG
ACCGTCGTTATCCTCAGAAATCGAAGAGCTGCCAGCAAAGTCGAGTTCACCACTTCATCGACTCATGGGCTACGCTTCGC
CAAGCCTAGTGATTAGAGGGTCTGGAACATCTCGGACAGGGAGAAGCTCATACCCATTGCACAGATAA