Details for Pear Locus Pbr001411.1

Position : scaf_103.0 ( 5`- 809163 .. 812589 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr001411.1

Protein [Map View]
MECKGEMPKDFGGGVQEAEKNKLFFFEGCYYNFDLEDLPRASAEVLGKGSFGTTYKAVLDEETTVVVKRLEEVVVGKREF
EQHMEVVERVGKHPNVLTPRAYYFSKDEKFLVYNYVPTGSLFAPLHGSSDAGRSPLDRDSRVKISLGIAKGLAHIHSEGA
KSSHDNIKSTNVLLTQELEACISDVGLSPLMNFPPAMSRAMGYRAPEAIDMRKITHKSDVYSFGVLLLEMLTGKTTLQYP
SYDCVVDLPRWVKSVVREEWTAEVFDLELLKQQHSEEEMVQMVQIALACVTKLPETRPNMDAVVRMIEELRQSSESEFDC
SGHNIDEVHQEGHHLAGGNVHLIKTMESWEEKLSEAIKDGKIVVANFSASWCRPCIMIAPAYCELADKYPSLLFLTLDVD
VLAELSTSWDIKATPTFVFLKDGRQVDKLVGGNKPELQKKTAAVMAQLATQSPRYLL*

DNA
ATGGAGTGCAAGGGTGAGATGCCTAAGGATTTCGGGGGTGGAGTGCAAGAGGCTGAGAAGAACAAGCTGTTCTTCTTTGA
AGGTTGCTATTACAATTTTGATCTTGAGGATCTGCCGAGAGCGTCAGCTGAAGTTCTCGGCAAAGGAAGTTTCGGAACAA
CTTACAAAGCTGTATTGGATGAGGAAACAACGGTTGTAGTGAAGCGGTTGGAGGAAGTTGTGGTGGGGAAGAGGGAGTTT
GAGCAGCATATGGAGGTGGTGGAGAGGGTAGGGAAGCACCCGAATGTCCTGACTCCTCGCGCTTATTATTTCTCCAAAGA
TGAGAAGTTTTTGGTGTACAACTACGTGCCAACAGGAAGCTTGTTTGCACCCTTGCATGGAAGCAGTGATGCTGGGAGGT
CTCCACTAGACCGGGATTCAAGAGTAAAGATTTCGCTCGGGATTGCCAAGGGACTTGCCCACATTCATTCCGAGGGTGCA
AAATCTAGCCATGACAATATAAAGTCCACAAACGTCCTCCTCACCCAAGAACTCGAGGCTTGCATCTCGGACGTAGGGTT
GAGTCCTCTAATGAACTTCCCTCCAGCCATGTCACGGGCCATGGGATATCGCGCTCCAGAGGCAATTGACATGCGGAAAA
TCACTCACAAATCTGATGTCTATAGCTTTGGTGTGCTCCTCTTAGAAATGCTGACAGGCAAAACCACGCTTCAATATCCG
AGTTATGATTGCGTGGTTGACCTCCCGCGTTGGGTTAAGTCTGTTGTGCGTGAGGAGTGGACAGCTGAGGTTTTTGATTT
GGAACTTCTAAAACAGCAACACAGTGAAGAAGAGATGGTGCAGATGGTGCAGATTGCTTTGGCATGCGTAACAAAATTGC
CCGAAACACGCCCCAACATGGATGCAGTAGTCAGAATGATAGAGGAACTCCGGCAATCCTCCGAGTCTGAATTTGATTGT
TCCGGACACAATATCGATGAGGTTCATCAAGAGGGTCATCATCTTGCCGGCGGAAATGTGCACCTTATAAAGACCATGGA
AAGTTGGGAGGAAAAGTTATCAGAAGCAATCAAGGATGGAAAAATTGTTGTTGCAAATTTCAGTGCATCTTGGTGTAGGC
CCTGTATTATGATTGCACCAGCCTACTGTGAGCTTGCAGATAAATATCCTTCTCTCTTATTTCTAACCTTGGATGTTGAT
GTTCTCGCTGAGTTGAGTACTTCATGGGATATAAAGGCCACTCCGACATTCGTTTTTCTCAAAGATGGAAGACAAGTGGA
CAAACTCGTTGGAGGAAACAAGCCTGAGCTCCAGAAGAAGACAGCAGCCGTCATGGCTCAATTAGCAACCCAGTCTCCAA
GATACCTCTTGTGA