Details for Pear Locus Pbr001408.1

Position : scaf_103.0 ( 5`- 793833 .. 796414 -3` )
Annotation :
External links : CoGe
PGDD synteny : Pbr001408.1

Protein [Map View]
MSKPSSGIIQGLLRFHRNQISKPSSPSPPPFSTARRSYHSTNGPPPQFPSHPKPVPGSGGGSYSGPGLGYGLGMRFFSVK
PSNFSKIDAKKVFDKPLSAVSSAFSRYQGAIGLQIEAFWKRNNLVLLGIGAVLVCALLWRLMFGIASTFIGLSEGMAKYG
FLALSTAIVAFAGLHIRSRFTINPDKVYRIAMRKLNTSAGILEVMGAPLSGSDLRAYVMSGGGVTLKKFKPTFRSKRCFL
IFPVRGSERKGLVSVEVKKKKGQYDMKLLAVDIPMASGPDQRLFLIGDEEEYKVGGGLIAELRDPVVKAMAATKEFDNLD
QIEEEEDAEKALQEAERKHHEEIEKLEKTPSQ*

DNA
ATGTCAAAACCCTCGTCTGGGATCATCCAAGGCCTGCTTAGATTCCACCGCAATCAAATCTCAAAACCCTCGTCTCCGTC
TCCGCCTCCGTTCTCCACCGCCAGGAGGAGCTACCACTCCACCAATGGGCCTCCTCCCCAATTCCCCTCTCACCCAAAAC
CAGTTCCCGGCAGCGGTGGCGGAAGCTACTCCGGGCCGGGACTCGGTTACGGCCTGGGCATGAGGTTCTTCTCCGTCAAG
CCATCGAATTTCAGCAAAATCGATGCAAAGAAGGTGTTTGATAAGCCGCTCTCCGCGGTGTCATCTGCTTTCTCGCGGTA
TCAGGGGGCCATTGGGTTGCAGATTGAGGCGTTCTGGAAGAGGAACAATCTGGTGCTGTTGGGAATTGGCGCAGTGTTGG
TGTGTGCTCTGCTGTGGCGGCTCATGTTTGGGATTGCTAGCACCTTCATTGGACTCTCTGAAGGCATGGCCAAGTATGGC
TTCCTCGCCCTTTCTACCGCCATTGTCGCATTCGCTGGCCTTCACATCCGCTCGAGATTCACAATCAATCCTGATAAAGT
TTATAGAATCGCCATGAGGAAGCTTAATACATCTGCTGGGATTCTCGAGGTTATGGGTGCTCCTCTCTCTGGATCAGATC
TAAGAGCCTATGTAATGTCCGGAGGTGGGGTTACACTGAAGAAGTTCAAGCCAACTTTTAGGAGCAAGCGGTGTTTCCTC
ATTTTCCCTGTGCGAGGTTCTGAGAGGAAGGGTCTGGTTAGTGTAGAAGTAAAGAAGAAAAAAGGCCAGTATGATATGAA
GCTACTGGCAGTTGACATTCCCATGGCATCAGGACCTGACCAGCGTTTGTTCCTGATTGGTGATGAAGAAGAGTACAAAG
TTGGCGGTGGACTTATAGCTGAGCTTAGAGATCCGGTTGTGAAAGCAATGGCTGCAACCAAGGAATTCGATAATCTTGAC
CAGATTGAAGAAGAGGAGGATGCTGAAAAAGCACTTCAGGAGGCCGAAAGAAAGCACCATGAAGAAATTGAAAAGCTTGA
AAAGACCCCGTCACAGTGA