Details for Nelumbo nucifera Locus NNU_005350-RA

Position : megascaf_3 ( 5`- 1297754 .. 1299211 -3` )
Annotation :
External links : CoGe
PGDD synteny : NNU_005350-RA

Protein [Map View]
MDTTVESPWPGNFSIDRKRLINSLVRGRELTTQLQTILCNRLGHEDGSLSTEDLLPRILRSFTEAISALKSADSGEVCQN
PSSTNVSSPSCDGPRTEDSGESRKSPAVKDRRGDYKRRKVSETWTKITPTPIDDGRAWRKYGQKVILNCKYPRNYYRCTH
KNDQGCAATKQVQQIEDDPPKYRTIYKGQHTCKDISKPPQFIMDSTHTDSSSFVLSFQSDSDAPITNQQQLQEHHPFFSS
SFPPIIKQECQEEIPNHEMEELTHNQQSSSQYFLPSVPTSALPSTPGSDHGDVISGVYSCSTSSHSLDMSFVGDFDDVFH
FDDDDFFPV*

DNA
ATGGACACAACTGTTGAATCTCCGTGGCCGGGAAATTTCTCTATTGATCGGAAAAGGCTGATCAACAGTCTCGTGCGAGG
CCGTGAACTCACAACCCAACTTCAAACTATCCTCTGCAATCGCCTCGGACATGAGGATGGGTCCTTGTCCACCGAAGATC
TCCTCCCAAGAATCTTACGATCCTTCACCGAGGCTATTTCTGCACTCAAGTCCGCTGACTCCGGAGAGGTCTGTCAGAAC
CCGTCGAGTACGAATGTGAGTTCGCCCAGTTGTGATGGCCCAAGGACGGAAGATTCCGGCGAGAGCAGGAAGTCTCCAGC
AGTCAAGGATCGTAGAGGAGATTATAAGAGAAGAAAGGTTTCTGAGACATGGACAAAGATCACTCCCACTCCCATTGACG
ACGGCCGTGCGTGGCGAAAATACGGCCAAAAAGTGATCCTCAATTGCAAATACCCAAGGAACTATTATAGGTGCACTCAC
AAAAACGACCAAGGATGTGCAGCAACCAAACAAGTACAGCAAATTGAAGATGACCCACCAAAGTATCGAACTATATACAA
GGGCCAGCACACATGCAAAGATATATCAAAGCCCCCCCAATTCATCATGGACTCTACCCATACAGACTCCTCCTCCTTCG
TTCTAAGCTTTCAGTCAGACTCAGACGCTCCAATAACTAACCAGCAGCAGCTCCAGGAGCACCATCCCTTCTTCTCTTCC
TCTTTCCCCCCAATAATAAAACAGGAATGCCAGGAAGAAATCCCAAACCATGAGATGGAGGAGCTCACCCACAACCAGCA
ATCTTCATCACAATATTTTCTGCCATCTGTCCCTACATCAGCGTTGCCATCCACACCCGGGTCTGATCATGGGGATGTGA
TTTCGGGCGTCTACTCGTGTAGCACCAGCTCTCACAGTCTGGACATGAGCTTCGTCGGTGACTTTGATGATGTTTTCCAT
TTTGATGATGATGACTTTTTTCCGGTTTAA