Details for Nelumbo nucifera Locus NNU_004768-RA

Position : megascaf_1 ( 5`- 3996757 .. 3998664 -3` )
Annotation :
External links : CoGe
PGDD synteny : NNU_004768-RA

Protein [Map View]
MGTVESPWPENSPINRRKAINELVRGREFTTQLQIILRNPLGGHGSVSAEDLLPKILTSFTEAIAALNTTVESGEVSQNP
ASTHVSSPSCGDRATEDSGESKKSTVLKDRRGSYKRRKLLQTWTKLSATPIDDGRAWRKYGQKVILNSKYPRNYYRCTHK
NDQGCQATKQVQQTEDNPPMYRTTYIGDHTCIDMSKAPRFLLDSIHNNAFVLSFEPEAPRKQDQPHPFFSCFSPSIKQEC
KEVEIPSDPTHKQCSSEYHLSHDEITFGSSCPTTVLPSTPGSDHGDVISGVYSGSTSSRSLDNYFVGMSDFDDVFHFEED
IFQVSM*

DNA
ATGGGGACAGTGGAATCTCCGTGGCCGGAAAATTCGCCAATCAACCGAAGAAAGGCGATCAACGAGCTTGTCCGTGGCCG
TGAATTTACGACCCAGCTTCAAATTATCCTCCGGAATCCCCTCGGAGGTCATGGATCCGTGTCGGCGGAAGACCTCCTCC
CAAAAATCTTAACATCGTTCACTGAGGCTATTGCGGCACTCAACACCACTGTCGAATCCGGGGAGGTTTCCCAGAATCCG
GCGAGTACCCATGTAAGTTCGCCCAGTTGCGGTGACCGGGCGACCGAGGATTCCGGTGAGAGCAAAAAGTCTACGGTTCT
CAAGGATCGCAGAGGAAGTTATAAGCGAAGAAAGTTGTTGCAGACATGGACAAAGCTCAGCGCTACTCCGATCGATGACG
GCCGTGCGTGGCGGAAATACGGCCAGAAAGTGATCCTCAACTCCAAATACCCAAGGAACTACTACAGGTGTACCCACAAG
AACGATCAAGGCTGCCAAGCAACCAAACAGGTCCAACAAACCGAAGACAACCCGCCCATGTATCGGACCACATACATAGG
CGATCACACATGCATAGACATGTCAAAGGCTCCCCGATTCCTCCTGGATTCTATCCACAACAACGCTTTTGTGCTCAGCT
TTGAACCCGAAGCTCCGAGGAAGCAAGACCAACCCCACCCCTTTTTCTCCTGCTTTTCTCCCTCAATAAAACAGGAATGC
AAAGAGGTGGAGATCCCGAGTGACCCGACCCACAAGCAATGTTCATCGGAATACCATCTTTCCCACGATGAAATCACATT
CGGATCGTCCTGCCCCACAACAGTATTGCCGTCGACACCCGGGTCGGATCACGGGGATGTGATCTCGGGCGTGTACTCAG
GTAGCACCAGCTCTCGCAGTCTGGACAATTATTTTGTGGGGATGAGTGACTTTGATGACGTATTCCACTTTGAAGAGGAC
ATCTTTCAGGTTTCAATGTAA