Details for Nelumbo nucifera Locus NNU_004765-RA

Position : megascaf_1 ( 5`- 3907171 .. 3915273 -3` )
Annotation :
External links : CoGe
PGDD synteny : NNU_004765-RA

Protein [Map View]
MVNFGLNMTNRATTKVRLVRCPKCWGLLPELAPVYQCAGCGTVLQAKKRKDGRGVTSEALEQNLVQKNKHQDDHENKEST
SLSQKQDPRAEECSPSMNNGKEQIEHIDCNEMSSGSRNFPNGFTSLDNLDYSEWEETSPETRDIVKVGGNYGRPSSFESQ
YSDSQQPPTGERSLTLSVQEALDDSNPSKTDSSPLNGQLEHSPNISIHAFDHMRSRDTVETTEPFDYGVISEEFSGTLRD
ISKSPTRSSHAYDGSVSSYDVWDDQCPDRSPHLPESNLFGTKSCLELFSTKGRPTREDVFLYQKMRNNSDVQHQEKSSSN
EMHGLDVMGNFNWDKDELQEPVRHGIGAQDDLNPQESEGFHALQNCRSEKEDDFLSRDSYRRRSPVFYGNGSSSNYGHEA
FVRSSSLYSSGKLEYLDQIELLRKVNELIDQLNRSYNPREKLRGRVMARCSKQENHQPLLYYYEKPDAESLQFNDAKYPQ
NLPGPYKPTNRGHKNYAFPQIPFSGMATHRQYHVDCSCSRCFPEDRQCLTELPPSSMCYNKGPWGGHHGIRCCSPYGSTS
SSQQQHMDSNFHLHSFNTLSCEQNHMDHEVQKPYYRERPRSVKRHCRPIAGGAPFIVCHSCWKLLQIPADFLLLRKRYHQ
LQCGACAKILKFSLYKRGPIIPCTSSQTVPSTNEVGSNRDSTSRRNFTSASHSHEYPPADPVSYSEEYGLSICKSFSTEG
EPAFMPPLFPVLQGNRSVKMDPSSSCPEPMEERKMLNLKGSKNKNSGASTYSTQSSNVAKMEKLALEAEVVSTVSPLHQL
MGYSSPSEMIYRTSAVSED*

DNA
ATGGTGAATTTCGGATTGAACATGACCAATAGAGCCACTACAAAAGTTCGACTGGTTAGATGTCCCAAATGCTGGGGACT
TCTTCCTGAGTTGGCTCCTGTGTATCAATGTGCTGGATGTGGTACTGTTCTGCAAGCAAAAAAGCGCAAAGATGGGAGAG
GTGTAACCTCAGAAGCACTGGAACAGAATCTTGTGCAGAAGAATAAACATCAGGATGATCATGAAAATAAAGAATCAACA
AGCTTGAGTCAAAAACAAGATCCTCGTGCAGAAGAATGTTCCCCAAGTATGAATAATGGGAAAGAACAAATTGAACATAT
TGATTGCAATGAGATGTCATCTGGAAGTAGAAACTTTCCAAATGGATTTACCTCTTTAGATAACCTGGATTATTCTGAGT
GGGAAGAGACATCGCCAGAAACTAGAGATATTGTGAAAGTCGGTGGAAACTATGGAAGACCCTCTAGTTTTGAAAGCCAA
TATTCTGACAGTCAGCAGCCTCCTACAGGAGAAAGAAGCTTGACCTTGTCAGTTCAAGAGGCATTAGATGACAGCAATCC
TTCGAAGACTGATTCCTCACCTTTAAATGGACAGTTGGAACACTCTCCGAATATTTCTATTCATGCATTTGACCATATGC
GCTCAAGAGATACAGTGGAAACTACAGAACCCTTTGACTATGGTGTGATTTCTGAGGAGTTCAGTGGTACACTTAGAGAT
ATTTCAAAATCTCCAACCAGAAGTTCCCATGCTTATGATGGTAGTGTTTCTTCTTATGATGTCTGGGATGACCAGTGCCC
TGACCGATCTCCACACTTACCTGAAAGCAATTTGTTTGGAACTAAAAGTTGCTTGGAATTGTTCAGTACCAAAGGCAGGC
CTACAAGGGAGGATGTCTTTCTGTATCAAAAAATGAGGAACAATTCAGATGTGCAACATCAAGAGAAGTCCTCCTCAAAT
GAGATGCATGGACTTGATGTCATGGGCAATTTTAATTGGGATAAAGATGAATTACAAGAACCTGTCAGACATGGTATTGG
AGCTCAGGATGATCTAAATCCTCAGGAATCTGAAGGCTTCCATGCACTGCAAAACTGTAGATCAGAGAAAGAAGATGACT
TTCTCTCTAGGGACTCCTACAGAAGGAGATCACCTGTTTTTTATGGAAATGGCAGTTCCTCAAATTATGGGCATGAAGCA
TTTGTACGTAGCTCAAGTTTGTATTCATCTGGCAAACTTGAGTATCTTGATCAAATAGAACTCCTAAGAAAGGTCAATGA
ACTAATAGATCAGCTCAATAGATCGTACAACCCGAGAGAAAAGTTAAGGGGAAGAGTTATGGCCAGATGCAGCAAGCAGG
AAAACCACCAACCCTTGCTTTATTATTATGAAAAACCCGATGCAGAAAGTCTGCAGTTCAATGATGCAAAATATCCTCAG
AACCTTCCTGGTCCATATAAGCCAACAAATAGAGGACATAAAAATTATGCATTCCCGCAAATTCCTTTCTCAGGAATGGC
TACTCATCGTCAATACCATGTTGACTGTTCCTGTTCACGTTGCTTCCCAGAAGACCGACAATGTCTGACAGAGTTGCCTC
CCTCCAGCATGTGTTATAACAAAGGACCATGGGGAGGCCATCATGGTATCAGGTGCTGCAGCCCTTATGGTTCCACTTCT
TCTAGCCAACAACAGCATATGGACTCCAATTTCCATTTACACAGTTTTAACACACTGTCCTGCGAGCAGAATCACATGGA
CCATGAGGTGCAGAAACCATATTACAGGGAGAGACCTCGTTCTGTAAAGCGGCATTGCCGGCCCATTGCAGGTGGAGCCC
CATTTATAGTCTGCCACAGTTGCTGGAAACTGCTTCAGATACCTGCAGATTTTCTCCTCTTGAGAAAGAGATACCATCAG
TTACAGTGTGGTGCATGTGCAAAGATACTTAAATTTTCACTTTATAAGAGAGGTCCTATCATTCCTTGCACATCTAGCCA
GACTGTGCCTTCAACAAATGAAGTAGGTAGTAATCGTGATTCTACCTCTAGGAGGAACTTTACATCTGCATCTCATTCTC
ATGAATATCCACCAGCAGATCCAGTATCCTATTCTGAAGAGTATGGACTCTCTATCTGTAAAAGTTTTTCAACTGAAGGT
GAGCCTGCCTTCATGCCACCTCTATTTCCTGTCCTTCAAGGTAATAGAAGTGTTAAGATGGATCCTTCAAGTAGTTGTCC
AGAGCCAATGGAAGAGAGAAAGATGTTAAACTTGAAAGGCTCCAAGAATAAAAATTCAGGGGCATCTACTTATTCAACTC
AATCCTCTAATGTAGCTAAAATGGAGAAACTAGCCTTAGAAGCAGAAGTGGTGTCAACAGTTTCACCACTTCATCAGCTT
ATGGGATATTCTTCACCAAGTGAGATGATTTACAGGACTTCTGCTGTATCAGAAGATTGA