Details for Barrel medic Locus Medtr3g093970

Position : chr3 ( 5`- 42931195 .. 42932903 -3` )
Annotation :
External links : CoGe
PGDD synteny : Medtr3g093970

Protein [Map View]
MASSSSLGIGNNRLTAGVGIQKRCCDVNRVVTCSVAIGDWTRSTVNKGRISAVATATTTTVTANKMIVERNGKNRGGTTN
EAIQAQERLDRWMRESVVEIVKNLKEAPLLVQIYSKKKDETTKLATEKVEDWEAVKERWETGETPMPEGVIFVEELGEDE
AEDGGERGLKERTTKMWGVVVQGKGVGCDPVCYLLKTSRVGSGPGSGMGVFSTHFCLVRVKSFGETAQSQLKNCWLLQSH
WLRQ*

DNA
ATGGCTTCTTCGTCGTCTCTAGGTATCGGAAACAATCGTTTAACCGCCGGAGTTGGTATTCAGAAGAGATGTTGTGATGT
TAACCGAGTAGTGACGTGTTCTGTTGCGATCGGTGATTGGACTCGATCCACGGTCAATAAAGGGAGGATCTCTGCGGTGG
CGACGGCGACGACGACGACTGTGACGGCGAATAAGATGATTGTGGAACGTAATGGGAAGAACAGGGGAGGAACAACCAAT
GAAGCTATTCAGGCTCAAGAGAGGCTTGATAGGTGGATGAGGGAATCGGTGGTGGAGATTGTGAAGAATTTGAAGGAAGC
ACCGTTGTTGGTGCAAATTTATTCAAAGAAGAAAGACGAAACTACGAAGTTAGCGACGGAGAAGGTGGAGGATTGGGAGG
CCGTGAAGGAAAGATGGGAGACCGGTGAAACTCCGATGCCGGAGGGGGTTATATTTGTGGAGGAGTTGGGGGAAGATGAG
GCGGAGGACGGTGGTGAAAGAGGGCTGAAAGAAAGAACGACGAAGATGTGGGGGGTTGTGGTTCAAGGAAAAGGTGTTGG
GTGTGACCCGGTTTGTTATTTGTTGAAAACGAGCCGGGTTGGGTCTGGACCGGGTTCAGGAATGGGTGTTTTCTCGACCC
ATTTTTGTTTGGTGAGAGTGAAGAGCTTTGGAGAAACCGCACAGTCTCAACTTAAGAATTGTTGGCTATTGCAAAGTCAT
TGGTTGAGACAGTGA