Details for Barrel medic Locus Medtr3g093930

Position : chr3 ( 5`- 42916167 .. 42919917 -3` )
Annotation :
External links : CoGe
PGDD synteny : Medtr3g093930

Protein [Map View]
MLFKIIPSSKMSVMRVYLLCLFFLFLVTVTAVKAVNPSLNDDVLGLIVFKADIKDPKGKLTSWNEDDESACGGSWVGVKC
NPRSNRVVEVNLNGFSLSGRIGRGLQRLQFLRRLYLGNNNLTGSINANIATIDNLRVLDLSNNNLSGVVPDDFFRQCGSM
RVVSLARNRFSGNVPSSLGSCAAIATIDLSFNQFSGNVPKGIWSLSGLRSLDMSDNLLEGEVPEGVEAMKNLRSISLARN
SFSGKIPDGFGSCLLLRSIDFGDNSFSGSVPSDLKELVLCGYFSLHGNAFSGDVPDWIGEMKGLQTLDLSQNRFSGLVPN
SLGNIWSLKTLNLSGNGFTGNLPESMVNCTNLLALDVSQNSLSGDLPSWIFRWDLEKVMVVKNRISGRAKTPLYSLTEAS
VQSLQVLDLSHNAFSGEITSAVSGLSSLQVLNLSYNSLGGHIPAAIGDLKTCSSLDLSYNKLNGSIPSEVGGAVSLKELS
LENNFLIGKIPISIENCSSLKTLILSKNRLSGSIPSAVASLTNLKTVDLSFNNLTGNLPKQLSNLPNLITFNLSHNNLKG
ELPAGGFFNTISPSSVSGNPFICGSVVNKKCPVKLPKPIVLNPTNFSPDSGPGSPTPTLAHKRNILSISALIAIGAAAFI
VIGVIGITVLNLRVRSTTSRSPAALAFSAGDEYSRSPTTDANSGKLVMFSGEPDFSSGAHALLNKDCELGRGGFGAVYQT
VLGDGRSVAIKKLTVSSLVKSQEDFEREVKKLGKVRHQNLVELEGYYWTSSLQLLIYEFVSRGSLYKHLHEGSGESFLSW
NERFNVILGTAKALSHLHHSNIIHYNIKSTNILIDSYGEPKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACKTVK
ITEKCDVYGFGVLVLETVTGKRPVEYMEDDVVVLCDMVRGALDEGRVEECIDERLQGKFPVEEVIPVIKLGLVCTSQVPS
NRPEMGEVVTILELIRCPSGSEGQEELSG*

DNA
ATGTTATTCAAAATAATACCTTCATCCAAAATGAGTGTTATGAGAGTTTATCTTTTATGCTTGTTCTTCCTGTTTCTGGT
GACTGTGACAGCAGTGAAAGCTGTGAATCCGTCTTTAAACGACGACGTTTTGGGGTTGATTGTGTTCAAAGCGGATATAA
AAGATCCAAAAGGAAAGTTAACATCTTGGAATGAAGATGATGAAAGTGCTTGTGGTGGTAGTTGGGTTGGTGTGAAATGT
AACCCTAGATCTAATAGAGTTGTGGAGGTTAATCTTAATGGGTTTTCTTTATCCGGAAGAATTGGTCGTGGGTTGCAACG
GTTGCAGTTTCTTCGTCGGCTTTATTTGGGGAATAATAATCTTACTGGGAGTATAAATGCAAATATTGCTACTATTGATA
ACCTTAGGGTTCTTGATTTGAGCAATAATAATCTTTCTGGAGTTGTGCCTGATGATTTTTTTAGACAATGTGGGTCTATG
AGAGTTGTTTCTTTGGCTAGGAACAGGTTTTCTGGGAATGTTCCTTCGAGTTTAGGTTCATGTGCAGCTATTGCTACTAT
TGATTTGTCTTTTAACCAGTTTTCGGGGAATGTTCCGAAGGGGATTTGGAGTTTGAGCGGACTTAGGTCTCTTGATATGT
CTGATAATTTGTTGGAAGGTGAGGTTCCAGAAGGTGTTGAGGCGATGAAGAATTTGCGGAGCATTAGCTTGGCTAGGAAT
AGTTTTTCTGGGAAGATACCAGATGGTTTTGGGAGTTGTTTGCTTTTGAGGTCTATTGATTTTGGTGATAATTCTTTCTC
TGGTAGTGTACCTAGTGATTTGAAGGAATTGGTGTTGTGTGGTTACTTTAGTTTGCATGGAAACGCTTTCTCTGGAGATG
TTCCGGACTGGATTGGAGAAATGAAGGGGCTTCAGACATTGGATCTTTCTCAAAATAGATTTTCTGGTTTGGTACCAAAC
AGTTTAGGAAATATTTGGTCATTGAAAACGTTGAATCTTTCAGGAAATGGTTTCACTGGTAATCTACCCGAGTCCATGGT
GAATTGTACAAACCTCTTGGCCTTGGATGTTAGCCAGAATTCATTGTCTGGCGATCTTCCATCATGGATTTTCAGGTGGG
ATTTGGAGAAGGTTATGGTGGTTAAAAACAGAATAAGTGGTAGGGCGAAAACCCCTTTGTATTCCTTGACTGAAGCTTCT
GTTCAGAGTCTTCAAGTTTTGGATTTATCTCACAATGCATTTTCTGGTGAAATCACTTCTGCTGTTTCTGGTTTAAGCAG
CTTGCAGGTTTTAAATTTATCATATAACTCTCTTGGAGGTCATATTCCGGCTGCAATCGGTGATTTGAAAACGTGTTCTA
GTCTTGATTTGAGTTATAATAAGCTAAATGGAAGCATACCTTCGGAAGTTGGTGGAGCTGTTTCCTTGAAAGAACTGAGT
TTGGAAAACAATTTCCTTATCGGGAAAATTCCAATATCAATTGAGAATTGTTCTTCATTAAAAACTTTGATTCTGTCGAA
GAACAGGCTGAGTGGGTCGATACCTTCAGCAGTTGCAAGTCTCACCAACCTGAAAACTGTGGACTTGTCATTCAACAACC
TTACTGGAAACCTTCCCAAGCAATTGTCCAACCTTCCCAATCTCATAACCTTTAATTTATCTCACAACAACCTTAAGGGT
GAACTACCGGCTGGTGGTTTCTTCAACACCATTTCACCTTCGTCCGTTTCTGGCAATCCATTTATTTGTGGCTCTGTTGT
GAACAAGAAATGCCCTGTTAAACTCCCAAAGCCTATTGTTCTGAATCCCACCAACTTTTCACCTGACTCTGGCCCTGGAT
CACCTACTCCAACATTGGCTCATAAGAGAAATATCCTCAGCATTTCAGCACTCATTGCCATTGGTGCAGCTGCTTTCATT
GTTATTGGTGTCATTGGCATAACTGTTCTCAACCTCCGTGTTCGGTCCACCACATCTCGATCTCCAGCTGCTCTTGCTTT
TTCTGCAGGGGATGAGTACAGCCGCTCGCCAACCACAGATGCCAACTCCGGCAAGCTTGTCATGTTTTCAGGTGAACCTG
ATTTCAGCTCTGGTGCTCACGCTTTGCTTAACAAGGATTGCGAGCTTGGGCGTGGAGGATTTGGGGCTGTCTATCAAACA
GTTCTAGGAGACGGGCGTTCAGTTGCAATAAAGAAGCTCACCGTGTCAAGCCTTGTCAAGTCTCAAGAAGATTTCGAGAG
GGAAGTGAAGAAATTAGGAAAAGTCAGACACCAAAATCTCGTTGAACTCGAAGGCTATTATTGGACTTCATCACTACAAC
TTCTCATATACGAGTTTGTCTCCCGTGGTAGCCTTTACAAGCATCTCCACGAAGGATCAGGCGAAAGCTTCCTTTCATGG
AACGAGAGGTTTAACGTCATTCTCGGTACAGCAAAGGCCTTATCTCACTTGCACCACTCCAACATTATTCACTACAACAT
TAAGTCAACCAACATCCTTATCGATAGCTACGGTGAACCTAAAGTAGGAGATTACGGCCTAGCGAGATTACTACCAATGC
TTGACCGCTACGTCTTGAGCAGCAAAATTCAGAGCGCGCTCGGCTACATGGCACCAGAGTTTGCCTGCAAAACAGTGAAA
ATTACCGAAAAATGCGATGTTTATGGGTTCGGAGTCTTGGTTTTGGAGACTGTGACAGGGAAGAGGCCTGTAGAGTATAT
GGAAGATGATGTGGTTGTGCTTTGTGACATGGTTAGAGGAGCATTGGATGAAGGGAGGGTAGAGGAATGCATTGATGAAA
GACTACAAGGGAAGTTCCCAGTAGAGGAAGTGATTCCTGTGATTAAGCTTGGTTTGGTATGTACTTCACAAGTACCATCT
AATAGGCCAGAAATGGGTGAAGTAGTTACCATATTGGAGCTTATAAGATGCCCCTCAGGCTCAGAAGGACAAGAAGAGTT
GTCAGGATGA