Details for Barrel medic Locus Medtr3g093780

Position : chr3 ( 5`- 42847107 .. 42851695 -3` )
Annotation :
External links : CoGe
PGDD synteny : Medtr3g093780

Protein [Map View]
MSGKVVTKIRIVKCPKCRQLLPEPQGYSVYKCGGCGTDLQAKKQSSVANSDSSVPEINAAPGKASDLVFAGKQHSDRKRQ
VPLRKDSLKAKATASSRECYLDGNGEFDGGQLVPFKFTDEEELESELDIPKLSLRRHRVSNKGGPNNITHCEIEEISNNG
DFSLERPKEGLICSSDEDGNYDKSALIGDKPEMEITETNFGNLSLEGADAVLISGSDEEDANKEKSVTEGANPEVEIIGS
DLQGVEDLNNGNLPLEDFNSGIDGEDANSDKSALVGKKLEGEITGNNIAGEKLNNGKWPQEGEGEDLNIEDPNNDQSAIE
DTKSEVDTTEGTTTKNASNEIVDTLDTTELRDHSSEFSGVLGKEKLSKSSTTRSLYTAGSLMNAYTVAEGMTRKGKGLAN
SSSYGDLGTQHQSHVPHEKNHVMKDSTRNKNKVLDNTEHGYSRWIETKRDHKFPSRMPYRSGYESGRPSNGVHDEGSRFL
SHDSREDTDQEKMKLMRMVLKLQDQLNKTRYMSEETNGRVSAGASYKGIRSSAYQYHSHDLHEGRSSNALDHSRCIGRCN
HGIASRQRHKYLRIPYSAEATSCAHHVDHSCYHCCSRVLADSSPRVHFQHEDLYRSYPAQNCCPSSPQCFSETNSEFQRH
RASVVRKYLRDKHNLAKRHHKPVAGGAPFVTCHKCSNLLQLPADFLLYKRVCHKLKCGKCSEVLKFSLKNGSHVVPFSSN
TIGLPSRELHRRSEVISGSNIPSVSHVNYYQYSPAKPISYYDDYGLSVSRSFSSEVDLVSLTQQIHPLNGGKYVNPNVSP
SSTFKANIVASRYFNAIAAPTDTDESAGFSSSMSENRKLSAEKEVKPPQKGTLHKLMGYSTPSKVIRGASC*

DNA
ATGTCTGGTAAAGTGGTTACCAAAATTCGGATAGTTAAATGTCCTAAATGCCGGCAACTTCTTCCAGAGCCTCAAGGATA
TTCTGTGTACAAGTGTGGTGGATGTGGTACTGACCTTCAAGCTAAGAAACAAAGTTCGGTTGCGAACTCAGATTCTAGTG
TTCCAGAAATCAATGCAGCTCCTGGGAAAGCATCGGATCTTGTTTTTGCAGGTAAACAGCATAGCGATAGAAAGCGTCAG
GTTCCTCTCCGGAAAGATAGTTTGAAGGCTAAAGCAACTGCTTCTTCAAGAGAATGTTATTTGGATGGAAATGGTGAGTT
CGATGGCGGTCAGTTAGTACCGTTTAAGTTCACAGACGAAGAAGAACTGGAAAGTGAGTTGGATATACCTAAATTGTCAC
TCAGAAGGCATAGAGTGTCCAACAAAGGTGGTCCAAATAACATCACTCACTGTGAGATTGAGGAGATAAGTAATAATGGA
GACTTTTCATTAGAAAGACCAAAAGAGGGCTTAATTTGTTCATCTGATGAAGATGGCAATTATGACAAATCAGCTCTGAT
AGGGGACAAACCTGAAATGGAAATTACTGAAACTAATTTTGGAAACTTGTCGCTGGAGGGAGCAGATGCGGTGTTAATTT
CTGGATCAGATGAAGAAGATGCCAATAAAGAGAAGTCGGTTACAGAAGGTGCAAACCCTGAAGTGGAAATTATTGGAAGT
GATTTACAAGGAGTAGAAGACTTGAATAATGGAAACTTGCCACTGGAGGATTTTAATTCTGGAATTGATGGAGAAGATGC
CAATAGTGATAAATCAGCTCTAGTTGGTAAAAAACTTGAAGGGGAAATTACTGGAAACAATATAGCAGGAGAAAAATTAA
ATAATGGAAAGTGGCCACAAGAGGGAGAAGGAGAGGATTTAAATATAGAAGATCCTAACAATGACCAATCAGCTATAGAG
GATACCAAATCTGAAGTGGACACAACAGAAGGTACTACAACAAAAAATGCAAGCAATGAGATTGTAGATACATTAGATAC
CACAGAATTAAGAGATCATAGTTCAGAGTTTAGTGGTGTTCTTGGAAAAGAAAAACTGTCTAAATCCTCAACCACAAGAA
GCTTGTATACCGCAGGTTCTTTGATGAATGCTTACACCGTTGCTGAAGGAATGACCAGAAAAGGTAAAGGCCTTGCTAAT
AGCTCCTCGTATGGGGATCTTGGAACACAACATCAGTCACATGTGCCACATGAAAAAAACCATGTCATGAAAGACAGCAC
AAGGAATAAAAACAAAGTGTTGGACAATACAGAACATGGTTATTCACGTTGGATAGAAACAAAGAGAGATCACAAGTTTC
CATCCAGAATGCCTTACAGATCAGGCTATGAAAGTGGCAGGCCATCAAATGGAGTGCATGATGAGGGCTCAAGATTCCTT
TCACACGACTCGCGTGAGGACACTGACCAGGAAAAAATGAAACTGATGAGAATGGTTCTAAAGTTGCAGGATCAACTCAA
CAAGACTCGCTATATGAGTGAGGAAACAAATGGAAGAGTTTCTGCTGGTGCATCTTACAAGGGGATCCGTAGTTCTGCAT
ACCAATACCATAGCCATGACCTTCATGAGGGAAGGTCTTCTAATGCTCTTGATCACTCTAGATGTATCGGAAGATGTAAT
CATGGAATTGCGTCCCGCCAAAGGCATAAGTACTTGCGGATACCTTATTCAGCTGAAGCAACAAGTTGTGCACACCATGT
TGATCATTCTTGTTACCATTGTTGTTCCCGTGTCTTAGCAGATTCTTCTCCACGTGTTCATTTCCAACATGAAGATTTAT
ACAGGTCCTATCCAGCGCAAAATTGTTGCCCTTCAAGTCCACAATGCTTCAGTGAAACAAATTCTGAATTTCAGAGGCAT
AGGGCTAGTGTGGTGAGGAAATACTTAAGGGACAAACATAACTTGGCTAAGCGACATCACAAGCCAGTGGCAGGTGGAGC
TCCTTTTGTCACTTGTCATAAATGTTCAAACCTGCTTCAGCTACCTGCAGATTTTCTCCTTTATAAAAGAGTATGTCACA
AGCTGAAATGTGGTAAATGTTCAGAGGTACTCAAGTTTTCATTGAAGAATGGAAGTCATGTAGTACCTTTCTCGTCGAAT
ACTATAGGTCTTCCATCTCGTGAGCTTCACCGTAGAAGCGAGGTGATTAGTGGCAGCAATATACCATCAGTATCTCATGT
CAACTATTACCAGTATTCACCTGCAAAACCCATTTCATATTATGATGATTATGGGCTTTCTGTCTCTCGAAGCTTCTCTT
CAGAAGTAGACCTTGTTTCTCTTACACAACAAATCCATCCCTTGAATGGTGGTAAATATGTTAACCCAAACGTCTCTCCT
AGCTCAACATTCAAGGCAAATATTGTTGCTTCAAGATATTTTAATGCAATCGCGGCTCCAACGGATACAGATGAATCAGC
TGGATTTTCCTCCAGTATGTCTGAAAACAGGAAATTGTCAGCAGAAAAGGAGGTAAAGCCTCCACAAAAAGGTACTCTTC
ATAAACTCATGGGTTATTCTACACCAAGTAAAGTGATAAGAGGGGCATCTTGTTGA