Details for Cotton Locus Gorai.008G292500

Position : chr8 ( 5`- 56643075 .. 56646340 -3` )
Annotation :
External links : CoGe
PGDD synteny : Gorai.008G292500

Protein [Map View]
MAVEPLTSGVSDLINALFSLRSLRSLLVVLNAVVLLLLLPTRRRKRTSALKSEAGKDEKHEGRKKGSVGTKFRVPAAVVQ
RRSTAFAVDLEAAARRSLAIRRVVQDDDGVSMREFSLVSSARGDTLFIQIWTPISVQIRGVVFLMHGLNEHSDRYNDFAK
RLNTNGFKVYGMDWIGHGGSDGLHGYVHSLDYAVNDMKMFLERVFVENPGLPCFCFGHSTGGAIVLKATLDPQVENRVAG
IILTSPAVGVQPSHPIFVVLAPIMSFLLPRFQVHVANRRGNPVSRDPEALVAKYSDPLVYTGPLRVRTGYEILRITSYLQ
HNMKRLKVPFLVLHGMDDTVTDPKASQKLYDEASTDKTIKLYKGLLHDLLFELEREAIMDDIIQWLNVRA*

DNA
ATGGCGGTGGAGCCGTTGACGTCTGGCGTAAGTGATCTAATCAACGCGCTCTTCTCGTTACGATCGTTGAGGAGCTTGTT
GGTGGTGTTGAACGCCGTCGTTTTGCTTCTCCTGTTGCCGACCCGGCGACGGAAACGGACCTCCGCGTTGAAATCTGAAG
CGGGAAAGGATGAGAAACACGAGGGCAGGAAGAAAGGGTCTGTGGGGACTAAGTTTAGGGTTCCGGCCGCGGTGGTGCAG
CGGAGAAGCACGGCGTTTGCAGTGGACCTAGAGGCGGCAGCGAGGCGATCGCTGGCGATTCGGAGGGTGGTTCAGGACGA
TGACGGCGTTAGTATGAGGGAGTTTTCGTTGGTTTCTAGTGCAAGAGGTGACACGTTATTCATTCAGATTTGGACTCCCA
TTTCCGTACAAATCAGGGGAGTAGTTTTTCTTATGCATGGCTTGAATGAACACAGCGATAGATACAACGATTTCGCAAAG
CGACTTAATACTAATGGATTCAAGGTCTACGGAATGGATTGGATTGGACATGGTGGAAGTGATGGACTACATGGATATGT
TCATTCTCTTGATTATGCTGTTAATGACATGAAAATGTTCCTCGAAAGGGTTTTCGTTGAAAACCCAGGGCTTCCGTGTT
TCTGTTTTGGTCATTCTACGGGTGGTGCAATTGTCCTAAAAGCAACACTCGATCCCCAGGTTGAAAATCGAGTAGCAGGC
ATTATACTAACTTCCCCAGCTGTTGGTGTCCAGCCATCTCATCCGATCTTCGTGGTACTTGCCCCGATCATGTCATTTCT
ATTACCACGATTCCAAGTCCATGTTGCAAACAGAAGGGGGAACCCGGTTTCTAGGGACCCGGAGGCACTGGTGGCTAAAT
ATTCTGATCCATTGGTATACACCGGACCTCTTCGGGTAAGAACCGGCTACGAAATCCTTAGAATCACATCTTACTTGCAG
CACAATATGAAAAGATTGAAAGTCCCTTTCCTTGTTCTCCACGGCATGGATGATACCGTAACCGATCCTAAAGCTTCACA
AAAACTATACGACGAGGCCTCAACCGACAAAACGATCAAATTATACAAAGGTCTCTTGCATGATCTCCTCTTCGAACTAG
AACGAGAAGCTATAATGGATGACATAATTCAATGGCTAAATGTTAGAGCTTAA