Details for Cotton Locus Gorai.008G291700

Position : chr8 ( 5`- 56598160 .. 56597189 -3` )
Annotation :
External links : CoGe
PGDD synteny : Gorai.008G291700

Protein [Map View]
MALVRERRQLNLRLPLPDVSDRRPRFPLPLPLSSTATAVAASSVTIPATELERLEVLGHGNGGTVYKVQHKRTFKIYALK
VVYGDGDQTVRRQVFREMDILRKTDSPYIVRCYETYEKPSGDVAILMEHMDAGTLDTLLRNKGTFTELELAHITRQILKG
LSYLHAHKIIHRDLKPSNLLVNKKMEVKIADFGVSKMMTRTLEACNSYVGTCAYMSPERFDPDANGGNYDGFLGDIWSLG
LTLMELYVGHFPFLQAGQRPDWATLMCAICFGDPPSLPPGASDEFRNFMECCLQKESSKRWTASQLLNHPFLIKHPSPAS
ADN*

DNA
ATGGCCTTAGTTCGTGAACGACGCCAGCTTAATCTCCGTCTTCCGTTACCGGACGTTTCCGATCGCCGCCCTCGTTTCCC
TCTCCCACTCCCTCTTTCCTCCACAGCCACCGCCGTCGCTGCTTCTTCGGTCACCATTCCCGCCACCGAGCTCGAAAGAC
TCGAAGTTCTCGGTCACGGAAACGGCGGAACAGTGTACAAAGTCCAACATAAACGTACTTTCAAGATTTACGCTTTGAAA
GTCGTGTACGGCGACGGTGACCAGACTGTTCGCCGTCAAGTTTTCAGGGAAATGGATATTTTACGAAAGACTGATTCACC
TTACATAGTTCGTTGTTACGAAACGTACGAGAAACCTTCCGGCGACGTGGCGATTTTAATGGAGCATATGGACGCCGGCA
CTTTAGATACCCTTCTTCGTAATAAAGGCACTTTCACGGAGCTTGAACTTGCTCATATAACAAGACAGATTCTAAAAGGA
TTAAGCTATTTGCATGCACATAAAATCATTCACCGTGATCTTAAGCCGTCGAATTTATTGGTCAACAAGAAGATGGAAGT
CAAAATCGCCGATTTCGGAGTTAGCAAGATGATGACTCGGACGCTGGAAGCGTGTAATTCGTACGTCGGAACTTGTGCTT
ATATGAGTCCGGAGCGGTTCGATCCCGACGCTAACGGTGGTAACTACGACGGCTTCCTTGGTGATATATGGAGTTTGGGG
TTAACTTTAATGGAACTTTACGTGGGTCACTTCCCGTTTCTACAGGCCGGTCAAAGACCCGATTGGGCTACACTTATGTG
CGCCATATGTTTCGGCGATCCACCGTCTTTGCCGCCGGGTGCTTCCGATGAGTTCAGAAATTTCATGGAGTGTTGTTTGC
AAAAGGAATCTAGTAAAAGATGGACAGCTTCTCAGCTTTTGAATCATCCATTTCTGATTAAACATCCATCGCCGGCGTCA
GCCGACAACTGA