Details for Cotton Locus Gorai.008G291200

Position : chr8 ( 5`- 56574308 .. 56571751 -3` )
Annotation :
External links : CoGe
PGDD synteny : Gorai.008G291200

Protein [Map View]
MGGISEFLTIFSPFTNLFESILEKIPIKLPIPLEKMVSYVSYPRTGRHLQRYDNRGFRLVVGCIPYRYKKLEEASSNEEE
IEVLVISAQNGKGMLFPKGGWENDESMEDAAIRETLEEAGVLGIIECKLGKWSYKSKRQSIFHEGHMFPLLVKKELDLWP
EKNIRERKWVTISKAREECPHLWMKEALEELVRRHVQPATDEK*

DNA
ATGGGGGGAATCTCTGAATTTCTCACAATTTTTTCCCCATTTACCAATCTTTTCGAATCAATCCTTGAAAAAATCCCTAT
CAAATTACCAATCCCTCTTGAGAAAATGGTTTCTTATGTTTCTTATCCTCGTACTGGTAGGCATTTACAACGCTATGATA
ACAGAGGCTTTCGTTTAGTTGTTGGGTGTATACCATACAGATACAAGAAACTTGAAGAGGCAAGTTCAAATGAAGAAGAG
ATTGAAGTGCTTGTGATCAGTGCACAAAATGGTAAAGGCATGTTGTTCCCCAAAGGTGGATGGGAAAATGACGAATCCAT
GGAAGATGCTGCCATTCGTGAGACACTAGAAGAAGCTGGTGTCCTTGGCATTATTGAATGCAAATTAGGGAAATGGTCAT
ACAAAAGCAAGAGGCAAAGTATCTTCCATGAAGGCCATATGTTTCCTTTGCTTGTGAAGAAAGAATTAGATCTATGGCCT
GAGAAAAACATCCGAGAAAGGAAATGGGTAACCATCTCCAAAGCTAGAGAAGAATGCCCACATTTGTGGATGAAAGAAGC
TTTAGAAGAGTTAGTCCGCCGCCATGTGCAGCCGGCAACGGATGAGAAATAA