Details for Cotton Locus Gorai.008G290600

Position : chr8 ( 5`- 56519219 .. 56518728 -3` )
Annotation :
External links : CoGe
PGDD synteny : Gorai.008G290600

Protein [Map View]
MGNAVSCAPSIISGGGAVKVVFPNGNIQMYTKSVKAADLMVENPGQFVCDSGGLKVGFRVHGLTADEELERRRLYFLLPM
ELLYSVLTEEEMSCLSCKADKALKHASFNIGKILPVFNELCIFPFEAKSPPQNAVNDGAKDSVVVRFSKQRSWKPALETI
VES*

DNA
ATGGGGAATGCAGTTTCTTGTGCGCCGTCGATCATCTCCGGCGGTGGAGCAGTGAAAGTGGTGTTTCCAAATGGGAACAT
TCAGATGTATACGAAATCAGTCAAAGCGGCGGATCTAATGGTGGAGAATCCGGGTCAGTTCGTGTGCGATTCCGGCGGTT
TAAAAGTGGGTTTTCGGGTTCATGGGTTGACGGCAGATGAAGAGTTGGAACGGCGGCGACTTTATTTCCTTCTTCCCATG
GAATTGCTTTACTCGGTGCTGACGGAAGAGGAAATGAGTTGCCTCAGTTGTAAGGCAGATAAGGCGTTGAAACATGCGAG
CTTTAATATTGGGAAGATTTTACCTGTTTTTAATGAGCTTTGCATTTTCCCGTTTGAAGCTAAGTCCCCGCCGCAAAACG
CCGTGAACGACGGTGCGAAAGATTCCGTCGTGGTGAGATTTTCGAAGCAGAGATCGTGGAAACCGGCGTTGGAGACCATT
GTTGAAAGTTGA