Details for Cotton Locus Gorai.007G007900

Position : chr7 ( 5`- 631801 .. 631292 -3` )
Annotation :
External links : CoGe
PGDD synteny : Gorai.007G007900

Protein [Map View]
MAERNNPTHQQQQQQRPSRANRTVVPSSTFLQKIQSHAPNTTHFLGFLLLFFVSAATLLILTGLTLTATVFGLVCFMPVI
VVSSPVWFPICTYLFLTAVGFLSACGFGVAVAAGSTWMYRYFRGMHPPGSDRVDSARTRIYDTASHVKDYAMEYGGYLQS
KVKDAAPGA*

DNA
ATGGCGGAACGTAACAATCCCACCCACCAACAACAACAACAACAACGACCGTCGAGAGCCAACCGCACCGTCGTCCCATC
CTCCACTTTCCTACAAAAAATCCAATCCCATGCACCCAACACCACCCACTTTCTCGGATTCTTACTCCTCTTCTTCGTTT
CCGCCGCCACTCTCTTAATCCTCACTGGACTTACTCTCACCGCCACCGTCTTTGGGCTCGTTTGTTTCATGCCGGTGATC
GTCGTTTCTAGCCCCGTTTGGTTCCCGATATGCACCTACCTGTTTCTCACCGCCGTTGGGTTCTTGTCGGCGTGTGGCTT
CGGAGTCGCCGTCGCGGCTGGGTCGACATGGATGTACCGTTACTTTAGGGGAATGCATCCACCTGGGTCGGACCGGGTTG
ATTCAGCTCGGACCCGGATTTATGATACGGCTAGCCATGTTAAGGATTATGCTATGGAATATGGTGGGTATTTGCAAAGC
AAGGTTAAGGATGCTGCTCCTGGTGCATGA