Details for Cotton Locus Gorai.007G007500

Position : chr7 ( 5`- 601610 .. 602671 -3` )
Annotation :
External links : CoGe
PGDD synteny : Gorai.007G007500

Protein [Map View]
MFPSNSNGNNNDPITYLDHSILPLSFFHSPSSPNYNQCELLQLDEYDYDVLWNQQQHFDDDDDQFLHQTTLLTDNSVSET
IVNLPDCRHNNTTTDIHQQPMPRKRPAASKTDRHSKINTANGPRDRRMRLSLDVAREFFGLQDMLGYDKASRTVEWLLVQ
AKPEITKLMNNNNNSFGFAKSPSSTSETEVVSGIDKAAAIDGNIPKGTPSKKEKKERRQRKTSFRPLARDMRVKARERAK
ARTKEKNMSLRLNNETRDNDPNRFSSSWSSTWTKQPGIQNHHNNNNTVFQADNINIHGDRMIWSLNCLQNTGLINQELTG
SILW*

DNA
ATGTTTCCTTCAAACAGCAATGGTAATAACAATGACCCAATCACTTATCTTGACCATTCGATTCTCCCTCTTTCCTTTTT
CCATTCCCCTTCTTCTCCGAATTACAATCAATGCGAGCTATTACAACTTGATGAATATGACTATGATGTTTTGTGGAACC
AACAACAACACTTTGATGATGATGATGATCAGTTCCTTCATCAAACAACCTTGTTGACTGATAATTCAGTGTCGGAAACT
ATCGTCAACTTGCCTGATTGTCGTCATAATAATACCACAACCGATATTCACCAACAGCCGATGCCACGAAAGAGACCAGC
TGCTTCAAAAACAGATCGGCACAGTAAGATTAACACGGCGAATGGACCGAGAGACAGGAGAATGAGGTTATCCCTTGATG
TCGCTCGAGAGTTCTTTGGTTTACAAGACATGTTGGGGTACGATAAAGCCAGTAGAACCGTGGAATGGCTACTCGTACAA
GCAAAACCAGAAATCACGAAGCTAATGAATAACAACAACAACAGCTTTGGCTTTGCTAAGAGTCCATCTTCGACATCCGA
GACCGAAGTGGTGTCCGGGATCGACAAAGCAGCTGCCATTGATGGAAACATTCCTAAAGGGACACCTTCAAAGAAAGAGA
AAAAAGAAAGACGACAACGTAAAACCAGTTTCCGTCCTCTCGCAAGGGATATGAGGGTAAAGGCACGGGAAAGAGCTAAA
GCAAGAACCAAAGAAAAGAACATGTCTTTAAGGTTAAACAATGAAACAAGAGACAATGATCCAAATAGGTTCAGTTCTTC
TTGGAGCTCAACTTGGACCAAACAACCTGGGATTCAAAATCACCACAACAACAACAACACTGTCTTTCAGGCGGACAACA
TAAATATCCATGGAGATCGCATGATTTGGAGCCTGAATTGTCTGCAAAACACTGGATTAATTAACCAAGAGCTTACAGGC
TCAATCCTTTGGTAA