Details for Cotton Locus Gorai.007G007000

Position : chr7 ( 5`- 560549 .. 565865 -3` )
Annotation :
External links : CoGe
PGDD synteny : Gorai.007G007000

Protein [Map View]
MGFACGSLLHPFISITMASPTLSQSLPKPFSFKPTIAISSSMVSPTSSSSSSSTGSYSPHWDNSILRQPTTSYDSPPEIL
RQWIELQQPLASHDRFTVASYNILGDRNASKHKDLYLNVPSNYIRWGYRKRVLCEEIMRWNPDIICMQEVDKYFDLRNTM
EKAGYVGSYKRRTGDNVDGCATFWKPDKFRLLERESIEFKGFGLRDNVAQLSVFEMCRVESRRLVVGNIHVLYNPSRGEV
KLGQIRFLSSRAQLLSNRWGNAPVVLGGDFNSTPQSAIYKFLSTSELNVKLYNRRELSGQRSCYPSEVLGGNRESRSSIS
VMDRVLNDCWTDEEVKAATGTANSRLVMHPLQLNSSYATVKGSTNTRHSNGEPLATSYHSKFLGTVDYLWYSEGVLPIRV
LDTLPIDILTRTGGLPCKKIGSDHLALVSEFAFSKSTIEDDNLTTPAVLCLD*

DNA
ATGGGGTTCGCCTGTGGTTCTTTGCTCCACCCTTTTATCTCCATAACAATGGCTTCCCCAACTCTAAGCCAATCATTGCC
TAAACCCTTTTCCTTCAAGCCCACCATTGCCATTTCTTCTTCCATGGTTAGCCCAACAAGTTCTTCTTCGTCCTCTTCCA
CTGGTTCCTACAGTCCCCACTGGGACAACTCCATTCTTCGACAACCGACCACATCGTACGATTCTCCTCCTGAGATACTC
CGCCAGTGGATCGAACTCCAACAACCTCTAGCTTCTCACGATAGATTTACTGTGGCATCATATAACATATTGGGAGATAG
AAATGCTTCAAAACATAAAGATTTGTACCTAAATGTTCCTTCAAATTACATAAGATGGGGTTACCGGAAAAGGGTTTTAT
GTGAAGAAATAATGAGATGGAACCCAGATATAATCTGTATGCAGGAGGTGGATAAGTACTTTGATCTAAGGAACACCATG
GAGAAGGCAGGATATGTTGGGTCTTATAAGCGACGTACCGGAGATAATGTTGATGGGTGTGCTACATTTTGGAAACCTGA
CAAGTTCCGATTGTTGGAGAGGGAAAGCATCGAATTTAAGGGATTCGGTCTTCGTGATAATGTTGCTCAGCTTTCTGTTT
TTGAGATGTGCAGAGTTGAATCTAGAAGACTAGTTGTTGGTAACATTCATGTGCTTTATAACCCAAGCCGTGGAGAAGTA
AAGTTAGGCCAAATTCGTTTTCTCTCTTCGAGGGCACAATTACTCTCCAACAGATGGGGGAATGCCCCAGTTGTACTTGG
GGGTGATTTTAATAGCACTCCTCAGAGTGCAATATACAAGTTCTTGTCAACATCAGAGCTTAACGTCAAGTTGTATAACA
GAAGAGAGTTGTCGGGTCAGAGAAGTTGCTATCCCTCTGAAGTTTTGGGTGGTAACAGAGAATCAAGAAGTTCAATTTCT
GTTATGGACAGAGTTTTGAATGATTGTTGGACTGATGAGGAGGTTAAAGCTGCAACTGGAACTGCTAATAGCCGTTTAGT
TATGCATCCATTGCAGCTTAATAGCTCCTATGCCACAGTAAAGGGTTCTACAAATACAAGGCACTCCAACGGTGAACCTT
TAGCCACTTCCTACCACTCTAAGTTTCTTGGAACTGTTGACTATTTATGGTACTCGGAAGGCGTTCTACCTATTAGAGTT
CTGGATACTCTTCCAATTGATATTCTCACGAGGACTGGTGGCCTTCCATGCAAGAAAATCGGAAGCGATCATTTGGCCTT
GGTTTCTGAATTTGCCTTCTCTAAAAGTACCATAGAAGATGATAACCTGACTACACCAGCAGTCCTTTGTTTGGATTAA