Details for Cotton Locus Gorai.007G005200

Position : chr7 ( 5`- 419751 .. 401807 -3` )
Annotation :
External links : CoGe
PGDD synteny : Gorai.007G005200

Protein [Map View]
MRLKQEDIFLNNNTNNLYVSEIPVDKQKLAAPIKSVVDKFQILPEFLKVRGLVKQHFDSFNYFVNTGIKKVVSANDRIVS
HIDPAIYLRFNDVRIGNPSMTTYEKINPHTCRLADMTYAAPIFADIEYMQESHGQRTRLEKKNVVMGRMPIMLRSCRCVL
YGKDEAELARLGECPLDPGGYFIINGAEKVIPIREQLAKNRIIIDADNKGNITASVTSISETIKSRTVIKMDKEKIYLLL
NQFVKKIPIMVVMKAMGIESDQEVMQMVGADPCYSALLLPSIEECARIDIYTQEQALAYLNTKVQYSSELGAFLILRDIF
LANVPVRCNNLRPKCLYVAVMLRRMMEATLNKHAMDDKDYMGNKHLELSGQLISLLFECYCLGVEDMELLSGEELHTPNS
FLVMLNGLILGKHRRPQHFANALRKLRRAGKIGEFVSVFVNEKQRCVYISSDGGRVCRPLVIVDKGISRIKEHHMKELLD
GVRTFNDFLGDGLVEYLDVNEENNALIALYEGEVTPETTHIEIEPFTILGCAMGKQAMGNIAYNQLCRMDTLLNILVYPQ
RPLVTTRTIELVGYDKLGAGQNATVAVMSCSGYDIEDAIVMNKASLDRGFGRCNVMKKYSNIIQKSRTGASDSILRPQRT
GPGSERMQILDDDGIAAPGEIIRPNDILLNKVSIHTRGIPISSEPLMDSACRPAKQLYKGPEGESCVLDRVALSSDQNGN
LSIKFLIRHTRRPELGDKFSSRHGQKGVCGIIIQQEDLPFSERGICPDLIMNPHGFPSRMTVGKMIELLGGKAGVSCGRF
HYGSAFGEPSGHADKVETISETLIKHGFCYNGKDFIYSGITGFPLQAYIFMGPIYYQKLKHMVLDKMRARGNGPRVMLTR
QPTEGRTRKGGLRVGEMERDCLIAYGASMLIYERMMLSSDPYDVQVCRKCGLIGYYSHKLKIGFCSSCKIGENVSSMKLP
YACKLLIQELQSMNIVPRLKLVEP*

DNA
ATGAGACTCAAGCAAGAAGATATATTTCTCAATAACAACACCAATAACTTATACGTGTCTGAGATACCAGTGGACAAGCA
AAAGCTTGCTGCTCCAATAAAATCGGTTGTTGACAAGTTTCAGATTCTCCCTGAGTTTTTAAAGGTTAGAGGGTTAGTGA
AGCAGCACTTCGATTCATTTAATTATTTTGTTAATACTGGAATCAAGAAGGTTGTTAGTGCCAACGACCGGATTGTATCC
CATATTGACCCCGCTATTTACCTCAGGTTTAATGATGTTAGAATTGGTAATCCCTCCATGACGACTTATGAAAAAATAAA
TCCCCATACATGCCGCCTCGCAGATATGACGTATGCTGCACCGATATTCGCCGACATAGAGTACATGCAAGAGAGTCATG
GGCAGAGAACTAGACTAGAAAAGAAAAATGTTGTTATGGGAAGAATGCCGATCATGTTAAGAAGTTGCCGCTGTGTGTTA
TATGGAAAAGACGAAGCTGAACTTGCAAGGCTTGGTGAATGCCCTCTTGATCCCGGTGGGTATTTTATTATTAATGGAGC
AGAGAAGGTGATTCCAATACGTGAACAGCTAGCCAAGAATAGGATAATTATTGATGCAGACAACAAGGGAAATATAACGG
CATCTGTAACAAGCATATCGGAAACAATAAAAAGCCGAACAGTTATTAAGATGGACAAAGAGAAGATATATTTGTTACTC
AACCAATTTGTGAAAAAGATCCCTATTATGGTGGTCATGAAAGCAATGGGGATAGAGAGTGATCAAGAGGTTATGCAAAT
GGTTGGTGCTGATCCTTGTTATAGTGCTCTTCTTTTACCTTCTATAGAGGAATGTGCACGTATTGACATATATACCCAAG
AACAAGCATTGGCGTACCTTAATACGAAGGTTCAATACTCTTCGGAACTGGGAGCTTTTTTGATCCTTCGAGATATCTTT
CTTGCCAATGTTCCAGTGCGTTGCAATAATTTGCGTCCAAAATGCTTGTATGTTGCGGTTATGCTGAGAAGGATGATGGA
GGCAACATTAAATAAGCATGCAATGGATGACAAGGATTATATGGGGAACAAGCATCTCGAGCTATCAGGACAATTAATCT
CTCTTCTTTTTGAATGCTATTGCTTGGGGGTTGAAGACATGGAGCTACTATCAGGAGAAGAGCTTCATACGCCAAATTCA
TTCCTGGTTATGTTAAATGGGCTGATTCTTGGCAAACATAGAAGGCCACAGCATTTTGCTAATGCTCTGAGAAAGCTGCG
AAGAGCTGGCAAAATTGGTGAGTTTGTGAGCGTCTTCGTAAATGAAAAGCAGAGGTGTGTGTATATTTCTTCCGATGGAG
GTCGAGTTTGTCGACCATTGGTAATAGTTGACAAGGGAATATCGAGGATCAAAGAACACCATATGAAGGAGTTGCTGGAT
GGAGTCCGTACTTTTAATGACTTTTTAGGTGATGGATTAGTTGAGTATCTTGATGTCAACGAGGAGAACAATGCTTTGAT
TGCTTTGTATGAAGGAGAGGTTACACCTGAAACTACTCATATTGAGATAGAGCCTTTCACAATCTTAGGTTGTGCAATGG
GGAAGCAAGCAATGGGAAATATTGCATATAACCAGTTATGTCGGATGGACACATTACTTAATATATTGGTGTATCCTCAG
AGGCCTTTAGTGACAACAAGGACAATTGAACTGGTTGGATATGATAAGCTTGGAGCTGGTCAGAATGCAACTGTTGCAGT
CATGAGTTGCAGTGGTTATGACATAGAGGATGCTATTGTCATGAACAAGGCTTCTCTAGACCGTGGTTTTGGGCGTTGTA
ATGTGATGAAAAAGTATTCTAACATTATTCAGAAATCTCGAACTGGTGCATCCGACAGTATTCTTAGGCCACAGAGAACC
GGACCTGGTTCCGAGAGGATGCAGATATTAGATGATGATGGAATTGCTGCTCCTGGGGAGATTATTAGACCAAATGACAT
CCTTCTTAATAAGGTCTCTATTCATACAAGAGGGATTCCAATATCTTCAGAACCTCTAATGGATAGTGCTTGTAGACCTG
CAAAGCAACTGTATAAAGGTCCTGAAGGAGAGTCTTGTGTACTGGATAGAGTTGCTCTTAGCTCTGATCAGAATGGAAAT
TTATCAATAAAATTTTTAATACGCCACACACGTCGACCTGAACTTGGTGACAAATTTAGTAGCAGACATGGCCAGAAAGG
TGTCTGCGGCATTATCATTCAGCAGGAAGATCTCCCCTTCTCAGAGCGTGGCATTTGCCCCGATTTAATTATGAATCCTC
ATGGTTTTCCAAGTCGAATGACTGTAGGCAAGATGATAGAGCTTCTTGGAGGCAAAGCTGGAGTTTCATGTGGTAGGTTC
CACTATGGTAGTGCTTTCGGGGAGCCTAGTGGTCATGCGGATAAGGTTGAAACTATAAGTGAAACCCTCATCAAGCACGG
TTTCTGTTACAATGGCAAGGACTTCATTTATTCAGGTATTACGGGTTTTCCATTACAAGCTTATATTTTTATGGGACCAA
TTTACTACCAGAAGTTAAAGCATATGGTTCTTGATAAAATGCGTGCCAGAGGTAATGGGCCTCGAGTTATGTTAACTAGA
CAGCCTACAGAAGGGAGAACTCGAAAAGGAGGGTTGCGAGTAGGAGAAATGGAGCGTGATTGTCTAATTGCTTATGGTGC
CAGTATGTTGATTTATGAGCGAATGATGTTATCCAGCGATCCATATGATGTCCAGGTTTGCCGAAAATGTGGTTTGATAG
GATACTACAGCCATAAGCTGAAAATTGGGTTTTGTTCTTCATGTAAAATTGGAGAAAATGTTTCTAGCATGAAACTACCA
TACGCATGCAAGCTTTTAATCCAGGAACTCCAGTCAATGAATATCGTTCCGCGTTTAAAATTAGTGGAGCCTTAA