Details for Cotton Locus Gorai.007G003300

Position : chr7 ( 5`- 282152 .. 272534 -3` )
Annotation :
External links : CoGe
PGDD synteny : Gorai.007G003300

Protein [Map View]
MVFKNKLFFSSSKKSGSSSPDGSSNSPRSTSNSPIRSDKKKPKASLPNSDSQQIPNSPSLFSPTAFKPTQVKDGPARKDL
KPSEPQTPVAKPSSSTSKKPDAKDGPSSVSPLLASSLGLNRIKTRSGPLPQESFFSFRGEKSAAASVLGASNLSRAGGSS
SAGGGGSSGKSGSGKKDGLNQRLLQESLLDNVSNSDSMSPGSGSGGWHSREQSPGVQGKSRLQNGESSSEAGRLKSSRGH
SGVLKSSDFCTPETSYDCENSKESESPRFQAILRLTSGPQKRFPADIKSFSHELNSKGVRPFPFWKPRRLNNLEEIVVVI
RAKFDKAKEEVNSDLAIFAADLVGLLEKNSESHPEWQETIEDLLVLARSCAMTPPGEFWLQCEGIVQELDDKRQELHPGT
LKQLYTRMLFILTRCTRLLQFHKESGLAEDEPVIQLRQSRVLHPADKRTSSGVLREAKSLSASKASKASTSKKSYSQEQH
WRKDHLVLPGSLITSIDDTQKNLESPASRDRIASWKKLPSPAKKSPKEVTASKEQNNSMIETWKKTGASDVDLAVVKLQE
PPPAKESQEHSSKHQHKVSWGYWGDQPNVSEESSIICRICEEEVPTSNVEDHSRICAVADCCDQKGLNVDERLVRIAEML
EKMTDLFANKDMQHVGSPDVAKVSNSSVTEESDVLSPKLSDWSRRGSEDMLDCFPEVDNSVLMDDLKGLPSMSCKTRFGP
KSDQGMTTSSAGSMTPRSPLLTPRNSQIDLLLAGKGVFTEQEDLPQMNELADIARCVANTPSVDDRSVPYLLSCLEDLRL
VIDRRKFDALTVETFGARIEKLIREKYLQFCELVEDEKLDISNTVIDEDAPLEDDVVRSLRTSPIHSSKDRTSIDDFEII
KPISRGAFGRVFLAKKRTTGDLFAIKVLKKADMIRKNAVESILAERNILISVRNPFVVRFFYSFTCRENLYLVMEYLNGG
DLYSLLRNLGCLDEEVARVYIAEVVLALEYLHSLHVVHRDLKPDNLLIAHDGHIKLTDFGLSKVGLINSTDDLSGPAVSG
TSLLDDEQPQLSASEHQQERRKKRSAVGTPDYLAPEILLGTGHGATADWWSVGVILFELIVGIPPFNAEHPQIIFDNILN
RKIPWPRAPEEMSLEAKDLIDGLLTEDPNQRLGAKGASEVKQHVFFKDINWDTLARQKAAFVPSSDSALDTSYFTSRYSW
NTSNDHTYPGSDFDDSSDADSLSGSSSCMSNRQDEVGDECGGLAEFESGSSVNYSFSNFSFKNLSQLASINYDLLSKGWK
DDHPANSNA*

DNA
ATGGTGTTCAAGAACAAGCTCTTCTTTTCCTCTTCTAAGAAATCGGGTTCTTCTAGTCCTGATGGATCATCCAATAGCCC
TCGTTCCACTTCTAATTCCCCGATCCGATCCGATAAGAAAAAACCCAAAGCTTCTCTTCCCAACTCTGATTCACAACAGA
TCCCTAATTCACCTTCCCTTTTCAGTCCCACTGCTTTTAAGCCAACCCAAGTCAAAGATGGACCCGCTCGCAAGGACCTC
AAACCCAGCGAACCCCAAACCCCAGTTGCTAAACCTTCTTCCTCTACCTCCAAGAAACCCGATGCTAAGGACGGGCCTTC
CTCTGTCTCGCCTTTACTCGCCTCTTCCTTGGGGTTGAATCGGATTAAAACTCGCTCCGGTCCCTTGCCCCAGGAGAGTT
TTTTCAGTTTTAGAGGGGAGAAAAGTGCCGCCGCTTCGGTGCTTGGAGCTAGTAACTTGTCCAGGGCTGGAGGTTCGAGT
AGTGCTGGGGGCGGTGGTAGTTCAGGGAAATCGGGTTCTGGGAAGAAAGATGGGTTGAACCAGAGATTATTGCAAGAGAG
TTTGCTTGATAATGTGAGCAATTCGGACAGTATGTCACCTGGAAGTGGTAGTGGTGGATGGCACTCGAGAGAGCAGAGCC
CTGGTGTACAGGGGAAGTCTCGGTTGCAGAATGGGGAATCATCCTCTGAAGCTGGACGACTCAAATCATCACGGGGGCAC
TCTGGAGTCTTAAAAAGTTCTGATTTTTGTACGCCAGAGACTTCATATGATTGTGAAAACTCCAAAGAGTCTGAATCCCC
CCGTTTTCAAGCCATTCTTCGCCTTACTAGTGGGCCGCAGAAGAGGTTTCCAGCTGATATTAAGAGCTTTTCCCATGAAT
TAAATTCAAAAGGAGTACGGCCTTTTCCATTTTGGAAACCTAGACGCTTAAACAACTTGGAGGAAATTGTGGTTGTGATT
CGGGCAAAATTTGACAAAGCAAAAGAGGAAGTGAACTCTGATTTGGCTATTTTTGCTGCCGATCTGGTTGGACTTCTTGA
AAAGAACTCTGAAAGTCATCCTGAGTGGCAGGAAACTATCGAGGATTTGCTGGTTCTGGCTCGAAGCTGTGCTATGACAC
CACCCGGAGAGTTTTGGCTTCAGTGTGAAGGCATTGTTCAGGAGTTAGATGATAAGCGTCAAGAACTTCATCCAGGAACA
CTGAAGCAGCTGTATACACGGATGCTTTTCATTCTCACAAGGTGTACAAGATTGTTGCAGTTTCACAAAGAAAGTGGGCT
GGCTGAAGATGAACCTGTGATACAGCTTCGCCAATCTAGAGTCCTGCATCCTGCAGATAAGAGAACTTCCTCGGGAGTCC
TAAGAGAAGCAAAAAGTTTGAGTGCGTCAAAGGCGTCAAAAGCCTCCACATCTAAGAAATCTTATAGTCAGGAGCAACAT
TGGAGGAAGGACCATCTTGTGCTGCCTGGAAGTTTGATCACTTCCATTGACGACACTCAAAAGAACTTGGAATCTCCTGC
AAGTAGAGATAGGATAGCTTCCTGGAAGAAACTCCCGTCTCCTGCCAAAAAAAGTCCAAAGGAAGTAACTGCTTCCAAGG
AGCAAAACAATAGTATGATTGAAACCTGGAAAAAAACAGGAGCTTCTGATGTAGATCTGGCTGTTGTTAAGCTTCAGGAA
CCTCCTCCTGCAAAAGAATCTCAAGAACACTCTTCCAAGCACCAGCACAAAGTTTCTTGGGGTTATTGGGGAGACCAACC
AAATGTTTCTGAAGAAAGTTCTATAATATGCCGCATTTGTGAGGAGGAGGTACCCACCTCAAATGTGGAAGATCACTCAA
GAATATGTGCTGTTGCTGATTGTTGCGATCAGAAGGGTTTAAACGTTGATGAACGCCTTGTAAGAATTGCTGAAATGCTT
GAGAAAATGACAGACTTATTTGCTAATAAGGATATGCAACATGTAGGGAGTCCAGATGTTGCTAAAGTATCAAATTCGAG
TGTGACTGAAGAATCTGATGTCCTATCTCCTAAACTAAGTGATTGGTCCAGGAGAGGTTCAGAAGACATGCTTGACTGTT
TTCCTGAAGTGGATAATTCAGTTCTTATGGATGACCTTAAGGGTTTGCCTTCAATGTCATGTAAAACTCGCTTTGGTCCA
AAGTCTGATCAAGGAATGACAACATCATCTGCAGGAAGCATGACTCCCAGATCTCCTTTATTGACACCAAGAAATAGTCA
AATAGACTTGTTATTGGCAGGCAAGGGTGTTTTTACAGAGCAAGAAGATCTTCCACAGATGAATGAACTTGCTGATATTG
CCAGATGTGTAGCAAATACACCATCAGTTGATGATCGGTCTGTGCCATATTTGCTGTCTTGTCTTGAAGACTTGAGACTT
GTCATAGACCGCAGAAAATTTGATGCACTTACAGTAGAAACGTTTGGTGCGCGCATTGAGAAGCTGATCAGGGAGAAGTA
CTTGCAGTTTTGTGAGCTAGTCGAGGATGAAAAGCTTGATATATCAAACACTGTCATTGATGAGGATGCTCCTTTAGAGG
ATGATGTGGTTCGTAGCTTGAGAACTAGCCCTATCCATTCATCTAAGGACCGTACCTCCATAGATGACTTTGAGATAATA
AAACCAATTAGTCGTGGAGCATTTGGGCGTGTTTTCTTAGCTAAAAAGAGAACAACAGGGGATCTTTTTGCAATAAAGGT
TCTAAAGAAGGCAGATATGATTCGCAAGAATGCAGTTGAAAGCATATTAGCAGAGCGTAATATTTTGATCTCAGTCCGCA
ACCCATTTGTGGTTCGCTTCTTCTATTCATTTACTTGCCGTGAGAACTTGTATCTTGTGATGGAGTATCTAAATGGAGGT
GATTTATATTCATTGTTGAGAAATTTAGGCTGCTTGGATGAAGAGGTTGCTCGTGTGTACATAGCGGAAGTTGTGCTTGC
CTTGGAGTATTTACATTCTCTGCATGTGGTTCATCGTGATTTGAAGCCTGATAATTTGTTGATTGCACACGATGGTCATA
TCAAGTTGACAGATTTTGGGCTTTCAAAGGTTGGTCTCATCAACAGTACTGATGACTTGTCTGGTCCAGCAGTTAGTGGA
ACATCTCTACTTGATGATGAGCAGCCTCAGTTATCTGCATCTGAGCATCAGCAAGAGAGGCGGAAGAAACGTTCTGCTGT
TGGTACACCTGACTATTTGGCGCCTGAGATTCTTTTGGGAACAGGACATGGTGCAACTGCGGATTGGTGGTCTGTGGGTG
TAATTTTATTTGAACTGATTGTCGGCATTCCACCCTTCAATGCAGAGCATCCACAGATAATATTTGATAATATTCTCAAC
CGTAAAATACCTTGGCCACGGGCACCAGAAGAAATGAGCCTTGAAGCAAAGGATTTAATTGATGGGTTGTTGACAGAAGA
TCCTAATCAGAGACTTGGAGCCAAAGGAGCATCAGAGGTGAAGCAACATGTATTTTTCAAAGATATCAATTGGGACACCC
TTGCAAGGCAAAAGGCTGCCTTTGTTCCCAGTTCAGACAGTGCACTTGATACTAGTTACTTTACCAGTCGCTACTCATGG
AATACTTCAAATGACCACACATATCCTGGTAGTGATTTTGATGATTCCAGTGATGCTGACAGCTTAAGTGGCAGTAGTAG
TTGCATGAGCAACCGACAAGATGAAGTGGGAGATGAATGTGGAGGTCTTGCTGAATTTGAGTCCGGTTCATCAGTAAATT
ATTCTTTCAGTAATTTCTCCTTTAAGAATCTATCCCAGCTCGCATCGATTAACTATGACCTGCTTTCTAAAGGGTGGAAG
GACGATCATCCAGCCAATTCTAATGCATAG