Details for Cotton Locus Gorai.007G002000

Position : chr7 ( 5`- 214298 .. 201347 -3` )
Annotation :
External links : CoGe
PGDD synteny : Gorai.007G002000

Protein [Map View]
MASYDKDEVPMLSDTYPQSSENNRDSQSQTFISRTRSASISIPLNSMESYQNTHLVGHTGPLRNERKTPFIQMSGPLYIS
RKPENSFQLNQSTAAGQKMMEPKAEKFPSFNGKDENDWPDNNYSGKNEHLLRSGQLGMCSDPYCTTCPTYYNFKPEQQKN
SRVSGIFDTKYAFYGDAKGWARRLVSFLCSYVPGIMNPHAKVVQQWNKFFVISCLMAVFIDPLFFFLLSVQKENKCIVID
WPATKLFVGLRSVTDFIYMLNMLLQFRLAYVAPESTVVGAGELVDHPKEIAFNYLGGYFSLDLFVVLPLPQIMISLVLPK
HLGSSGANFAKNLLRTAILIQYLPRLYRFLPFLAGQSPLGFIFESAWANFVINLLTFMLSGHVVGSSWYLLGLQRVNQCL
RNACGNSNIRNCKEFIDCGSGHSPNRNVLPIWTNNSNVSACFTEDGFSYGIYVPTVNLTTEPSIVTRYVYSLFWGFQQIS
TLAGNQTPSYFVWEVLFTMAIVGLGLLLFALLIGNMQNFLQALGRRRLEMSLRRRDVEQWMSHRRLPVELRRKVREAERY
NWAATRGVNEEVLIENLPEDLQREIRRHLFKFVKKVRIFALMNDTILDAICKRLRQKIYIKESYVLSRGCLIEKMVFIVR
GTMESVEENGIRNPLSEGDVCGEELLNWCLEHSSVNRDVKKIKLPGQSLHSISSREVRCVTNVEAFSIRAADLQEVTSLF
PRFFRTPRVIRAIRNESPYWKTFAAICIQVAWRYRKKRLNRANTSQSTCC*

DNA
ATGGCAAGTTATGATAAAGATGAGGTTCCAATGCTGTCAGATACCTATCCTCAGTCATCAGAAAATAATCGGGATTCTCA
ATCTCAGACATTTATCTCCAGGACTCGGAGTGCTTCAATTTCTATCCCATTGAACTCCATGGAATCGTATCAAAATACTC
ATCTGGTAGGGCATACTGGCCCCTTGAGGAATGAAAGAAAAACACCATTTATCCAGATGAGCGGTCCACTATATATCAGT
CGTAAGCCTGAAAATTCTTTTCAACTAAATCAAAGTACAGCGGCAGGCCAAAAAATGATGGAACCTAAGGCTGAAAAGTT
TCCTTCCTTTAATGGTAAGGATGAAAATGATTGGCCAGATAACAACTATTCTGGCAAAAATGAACATTTACTGAGGTCTG
GGCAACTAGGAATGTGCAGTGATCCTTACTGCACCACTTGCCCAACATATTACAATTTCAAACCAGAACAACAGAAAAAC
TCAAGAGTTTCTGGCATCTTTGATACCAAGTATGCTTTCTATGGGGATGCCAAAGGTTGGGCTAGGAGGTTGGTCTCTTT
TCTGTGCTCTTATGTTCCTGGTATTATGAACCCTCATGCTAAAGTTGTTCAGCAATGGAACAAATTCTTCGTCATTTCAT
GCTTGATGGCAGTTTTCATAGATCCACTGTTTTTCTTCTTGTTGTCTGTGCAGAAGGAGAACAAGTGCATAGTCATTGAT
TGGCCTGCGACTAAACTGTTTGTCGGGTTAAGAAGTGTGACCGATTTTATCTATATGCTTAACATGCTCCTTCAGTTCAG
GTTGGCTTATGTAGCTCCTGAGTCTACAGTAGTTGGTGCAGGAGAGTTAGTTGACCATCCAAAGGAAATTGCTTTCAATT
ACCTTGGGGGATACTTTTCTCTTGACTTGTTTGTGGTACTCCCACTTCCTCAAATCATGATATCATTGGTCCTACCAAAA
CATTTGGGATCGTCAGGAGCAAATTTTGCAAAAAATCTTTTACGGACAGCCATTCTTATTCAGTATCTTCCCAGATTGTA
TAGGTTTCTACCTTTCCTGGCTGGTCAGTCTCCATTGGGATTTATATTTGAGTCAGCATGGGCAAATTTTGTCATAAACC
TTCTCACTTTTATGTTGTCTGGCCATGTCGTTGGGTCATCGTGGTACCTCCTTGGATTACAGAGGGTTAATCAATGTCTT
CGAAATGCCTGTGGTAACTCAAATATCCGAAATTGTAAGGAGTTTATAGATTGTGGCTCCGGGCATTCTCCTAATCGCAA
TGTGCTGCCAATTTGGACGAACAATTCCAATGTCTCTGCCTGCTTTACAGAAGATGGATTTTCTTACGGAATATATGTAC
CAACTGTCAATCTAACGACAGAACCAAGTATTGTTACTAGATATGTATATTCATTGTTTTGGGGATTCCAGCAAATCAGT
ACTCTGGCTGGAAATCAAACTCCCAGCTATTTTGTTTGGGAAGTTCTTTTTACCATGGCCATTGTCGGACTAGGCCTCTT
GCTTTTTGCTCTTCTTATCGGAAATATGCAGAACTTTCTCCAAGCACTGGGACGGAGGAGGTTAGAAATGTCACTAAGAC
GTCGTGATGTGGAGCAATGGATGAGTCATCGACGCTTGCCTGTAGAGTTAAGAAGGAAAGTACGAGAGGCTGAACGATAT
AATTGGGCTGCCACAAGAGGGGTAAATGAAGAAGTGCTTATTGAGAACCTACCTGAAGACCTTCAGAGAGAGATAAGACG
CCATCTCTTCAAGTTTGTTAAGAAAGTTCGTATATTTGCTCTCATGAATGATACTATTTTAGATGCCATCTGCAAGAGAT
TAAGACAAAAGATCTATATTAAAGAAAGCTATGTTTTGTCTCGTGGTTGTCTGATTGAAAAGATGGTTTTTATTGTGCGT
GGGACAATGGAAAGTGTAGAAGAAAATGGAATAAGAAATCCCTTGTCTGAAGGGGATGTCTGTGGTGAGGAGCTTCTCAA
TTGGTGTCTTGAGCATTCTTCAGTAAACCGAGATGTGAAGAAAATCAAGCTTCCTGGACAGAGTTTGCATAGTATTAGTA
GCCGAGAAGTTAGATGTGTGACAAATGTTGAAGCATTTTCCATTCGGGCTGCAGACCTACAAGAAGTTACCAGTCTGTTC
CCTAGGTTCTTCCGCACTCCTCGAGTTATAAGAGCCATAAGGAATGAATCACCATATTGGAAAACCTTTGCTGCTATTTG
TATTCAAGTAGCGTGGAGATACAGGAAAAAACGTCTGAATCGTGCCAATACCTCTCAATCCACTTGTTGTTGA