Details for Soybean Locus Glyma.14G204100

Position : Chr14 ( 5`- 46886862 .. 46890243 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.14G204100

Protein [Map View]
MQDPSSNPNSNPNPNPHNANAASQLPRPPPATTAGAGASSSSLFARSGGPHHRRAHSEVSFRLPDDMMDLSPSDPFAGGS
STASMEEIGSEDDLFSTYIDVDKLGGANGSGASGNGADPTGETEKSPARPRHRHSSSVDFGEIMDAKKAMPPDKLAELWT
IDPKRAKRILANRQSAARSKERKARYIQELERKVQTLQTEATTLSAQLTLYQRDTTGLSTENTELKLRLQAMEQQAQLRD
ALNEALKKEVERLKVATGEMMSHTDSFNLGMHLMPFSGSNFVPIPPQSGPSGHQNMQMPPFGLTPSTMPSHLLHQTSSHP
YSEILQNDQLGRFQGLDISSKGSTLVKSEGPSLSASESSTTF*

DNA
ATGCAAGATCCATCTTCAAACCCTAATTCCAATCCAAATCCCAATCCTCACAATGCCAATGCCGCATCCCAGCTACCGCG
TCCACCGCCGGCCACCACCGCCGGCGCCGGCGCCTCCTCGTCCTCGCTGTTCGCGCGCTCCGGCGGGCCTCACCACCGGC
GAGCCCATTCGGAAGTGAGTTTCCGGCTGCCGGACGACATGATGGACCTCTCGCCGTCGGATCCGTTCGCCGGCGGGTCG
TCGACGGCCAGCATGGAGGAGATCGGATCGGAGGACGACCTGTTCTCGACGTACATTGACGTGGACAAGCTCGGCGGCGC
AAACGGGTCGGGCGCCTCCGGAAACGGAGCGGATCCGACCGGCGAAACCGAGAAGAGTCCGGCGAGGCCGCGACACCGGC
ACAGTAGCTCCGTCGATTTCGGGGAAATTATGGATGCGAAGAAAGCTATGCCTCCTGATAAGTTAGCTGAGCTATGGACA
ATTGATCCCAAGCGTGCTAAGAGAATACTTGCAAATCGGCAATCTGCTGCTCGATCGAAGGAGAGAAAAGCGCGCTACAT
ACAAGAACTTGAGCGCAAGGTTCAGACTCTTCAGACGGAAGCCACAACTCTTTCTGCCCAATTGACCTTATACCAGAGGG
ACACAACAGGACTGAGTACTGAAAATACAGAGCTAAAGCTCCGTTTGCAAGCCATGGAGCAACAAGCACAACTTCGTGAC
GCTCTTAATGAAGCATTGAAGAAGGAAGTTGAGAGGCTTAAGGTTGCTACTGGTGAGATGATGAGCCACACTGATTCCTT
TAATCTGGGAATGCACCTGATGCCATTTTCCGGATCAAATTTCGTTCCAATCCCGCCACAATCAGGTCCTTCTGGTCACC
AAAACATGCAGATGCCACCATTTGGTCTCACCCCATCCACAATGCCAAGCCATCTACTGCATCAAACAAGTTCTCATCCA
TATTCAGAAATATTGCAAAATGACCAGCTTGGTCGTTTCCAGGGGCTTGACATTAGTAGCAAAGGATCAACTCTCGTGAA
GTCTGAAGGCCCCTCACTCTCCGCAAGTGAGAGTAGCACTACATTTTGA