Details for Soybean Locus Glyma.14G203900

Position : Chr14 ( 5`- 46856580 .. 46859641 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.14G203900

Protein [Map View]
MAPHASSFALVLVIFLFVEMHFHGATADYGGWQGGHATFYGGGDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLS
CGACYEMRCDDDPRWCKPGTIVVTATNFCPPNFALANNNGGWCNPPLQHFDMAEPAFLQIAQYRAGIVPVAFRRVPCVKK
GGIRFTINGHSYFNLVLITNVAGAGDVHAVSIKGSRTSWQPMSRNWGQNWQSNSYLNGQSLSFQVTASDGRTVTSFNVAP
SDWQFGQTFQGGQF*

DNA
ATGGCACCCCATGCATCTTCTTTTGCTCTTGTTCTTGTCATTTTTCTCTTTGTTGAAATGCACTTCCACGGTGCCACTGC
TGACTATGGCGGCTGGCAGGGTGGTCATGCTACCTTCTATGGTGGTGGTGATGCTTCTGGCACAATGGGAGGTGCATGTG
GCTATGGGAATTTGTACAGTCAGGGATATGGAACCAACACTGCAGCTCTGAGCACTGCTTTGTTCAACAATGGCTTGAGT
TGTGGGGCATGTTATGAAATGAGGTGTGATGATGATCCAAGATGGTGCAAGCCTGGCACCATTGTTGTCACTGCTACAAA
CTTCTGTCCTCCAAACTTTGCTTTGGCCAACAATAATGGTGGTTGGTGCAACCCTCCTCTGCAACACTTTGATATGGCAG
AACCAGCCTTCCTTCAAATTGCTCAGTATAGAGCTGGAATTGTGCCTGTGGCATTTAGAAGAGTGCCCTGTGTGAAAAAG
GGGGGAATAAGGTTCACAATTAATGGCCACTCTTACTTCAACCTGGTTTTGATCACCAACGTCGCGGGTGCAGGGGATGT
CCATGCAGTGTCCATCAAAGGGTCCAGAACTAGCTGGCAACCCATGTCAAGAAACTGGGGGCAAAATTGGCAGAGCAACT
CCTACCTCAATGGACAAAGCCTCTCTTTTCAAGTCACCGCCAGTGACGGTAGAACTGTCACAAGCTTCAACGTGGCACCA
TCTGATTGGCAGTTCGGTCAGACCTTCCAAGGGGGTCAGTTTTAG