Details for Soybean Locus Glyma.14G203800

Position : Chr14 ( 5`- 46841491 .. 46853116 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.14G203800

Protein [Map View]
MGDLLVNGVVFGEDRPCASSPPSPPLPPSNPDPSSVAADAWAAAEKTTAEILSRIRPTLAADRRRREVVDYVQRLIRYGA
RCEVFPYGSVPLKTYLPDGDIDLTALSCQNIEDGLVSDVRAVLHGEEINEASEYEVKDVRFIDAEVKLVKCIVQDIVVDI
SFNQLGGLSTLCFLEKVDRLVAKDHLFKRSIILIKAWCYYESRVLGAHHGLISTYALETLVLYIFHQFHVSLDGPLAVLY
RFLDYFSKFDWDNYCVSLKGPVGKSSPPNIVAEVPENGGNTLLTEEFIRSCVESFSLPSRGADLNLRAFPQKHLNIIDPL
KENNNLGRSVNKGNFYRIRSAFKYGARKLGWILMLPEDRITEELIRFFTNTLERHGSTPGNVNKSFLSLSTASRKDRKPE
NQHNYDCRDERERYVVQDAGEFFDSSRYGNAVGSLKLCEDSKDVATSGVLDSASTNGWSYCSNGQFENNISDSEPALNSV
IDDEKEKQGVAGNSPRSHTDEKNMAVSEASKSLLDLTGDYDSHIGNLQYGHMCNGYPVSPVVPSPPRSPKFPNRNPWETV
RQCVQINHSIRSQANSNSVMGQQVYVINHPSLPMTSFGSEEKRKVRGTGAYFPNMTSRPYRDNRPMPGRGRGQAPGTHGH
LQRHTRNNGFALAPQEMNLSAEGTFEHALEGYPGLGSTKIRSSETYFPQPSTWGSHYANGFVHSSEKHESVHVSPQLQVV
PRNETSIYPESVISTPRGTVPNTGEVMEKSDSLSVVDSKSVFGGVHGHSNCRDDAPEKHA*

DNA
ATGGGCGATCTTCTTGTGAACGGCGTCGTTTTCGGGGAGGATCGCCCCTGCGCGTCCTCGCCTCCGTCACCGCCACTTCC
GCCTTCGAATCCCGATCCGTCCTCCGTCGCGGCTGACGCCTGGGCGGCGGCCGAGAAAACCACCGCCGAGATTCTCAGCC
GCATACGGCCCACGCTCGCCGCCGACCGCAGGCGCAGGGAGGTCGTCGATTACGTCCAGAGACTCATTCGGTACGGCGCG
CGCTGCGAGGTTTTTCCATATGGGTCAGTTCCGTTAAAAACATATCTTCCAGATGGAGATATTGATTTGACTGCACTCAG
TTGTCAAAACATTGAGGATGGCCTGGTATCTGATGTCCGTGCTGTTCTCCATGGAGAGGAAATCAATGAAGCTTCTGAAT
ATGAAGTAAAGGATGTTCGTTTCATTGATGCAGAGGTTAAGCTTGTTAAATGCATTGTACAGGATATTGTTGTAGACATC
TCTTTCAATCAGTTAGGAGGACTCAGTACATTGTGTTTTCTTGAGAAGGTTGATCGACTTGTTGCCAAGGATCATCTCTT
CAAACGTAGTATTATCCTTATTAAAGCTTGGTGCTACTATGAGAGTCGTGTACTGGGTGCCCATCATGGTCTGATTTCAA
CATATGCTTTGGAAACACTGGTTCTGTATATTTTCCATCAGTTTCATGTATCCTTAGATGGTCCTCTAGCAGTTCTCTAC
AGATTTTTGGACTACTTCAGCAAATTTGATTGGGACAATTATTGTGTTAGTTTGAAGGGACCAGTTGGCAAATCTTCTCC
GCCTAATATAGTAGCTGAGGTGCCTGAAAATGGAGGGAATACTCTACTGACTGAAGAATTCATTAGAAGCTGTGTGGAGT
CATTCTCACTACCATCAAGGGGGGCTGATTTAAATTTGCGCGCATTTCCCCAGAAACATCTTAACATCATCGATCCATTG
AAGGAAAACAACAATCTTGGCCGCAGTGTCAATAAAGGTAATTTCTATCGAATACGCAGTGCTTTTAAGTATGGTGCCCG
TAAACTTGGATGGATTCTTATGTTACCAGAAGATAGAATAACTGAGGAGCTTATTAGGTTCTTTACGAACACACTGGAAA
GGCATGGAAGCACTCCGGGGAATGTAAACAAGTCATTTTTGAGCTTATCTACAGCATCCAGAAAGGATAGGAAACCTGAA
AATCAACATAATTATGACTGCAGAGATGAAAGAGAAAGATATGTAGTACAAGATGCAGGGGAGTTCTTTGACTCCTCTAG
GTATGGAAATGCAGTTGGAAGTCTTAAACTTTGCGAAGATTCTAAGGATGTTGCAACATCTGGGGTCTTGGATAGTGCAA
GCACTAATGGTTGGTCTTATTGTTCAAATGGGCAATTTGAAAATAATATTTCTGATAGTGAACCTGCTCTAAATTCTGTT
ATTGATGATGAGAAAGAGAAGCAAGGTGTGGCTGGCAATTCACCCAGATCGCATACTGATGAAAAGAATATGGCAGTCTC
TGAAGCTTCAAAGTCATTGTTGGACCTTACAGGGGATTATGACAGTCACATTGGGAACTTGCAATATGGTCATATGTGTA
ATGGTTATCCTGTCTCTCCTGTGGTGCCTAGTCCTCCTAGGTCTCCGAAGTTTCCAAATAGGAATCCATGGGAAACTGTT
CGTCAATGCGTACAGATTAATCACAGTATTCGTTCTCAGGCAAACTCAAATAGTGTAATGGGACAACAAGTTTACGTCAT
AAATCATCCTTCTCTGCCAATGACTTCTTTTGGTTCAGAAGAGAAGAGAAAAGTACGAGGAACAGGCGCATACTTCCCTA
ATATGACTTCTCGTCCTTACAGGGACAATAGGCCAATGCCAGGAAGGGGAAGGGGTCAAGCACCAGGTACTCATGGACAT
CTGCAGAGACACACCCGTAACAATGGCTTTGCCCTAGCTCCACAAGAGATGAATTTGTCTGCGGAAGGAACCTTTGAACA
TGCTCTAGAAGGATATCCTGGTCTTGGTAGTACTAAAATCAGATCATCTGAGACCTATTTCCCTCAACCTTCTACATGGG
GATCACATTATGCTAATGGTTTCGTTCATTCATCTGAGAAACATGAATCTGTACATGTGAGCCCTCAGCTTCAAGTAGTG
CCAAGAAATGAAACTAGCATTTACCCAGAGTCAGTCATTTCTACTCCTAGGGGCACTGTGCCTAACACTGGGGAGGTGAT
GGAGAAGTCTGATTCATTGTCAGTAGTTGATTCCAAAAGTGTCTTTGGTGGAGTCCATGGCCATTCAAATTGCCGTGATG
ATGCCCCCGAGAAACATGCGTAG