Details for Soybean Locus Glyma.09G190900

Position : Chr09 ( 5`- 41563721 .. 41565975 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G190900

Protein [Map View]
MEENSSLEHHYYYPLPASSAAAEADHPNNHNDGDKEETCAEEGRSQYKPNTSQNYVSYQSNRSRLNGYALCGAILASTNS
ILLGYDIGVMSGASLFIRQDLKITSVQVEILVGSLNVCSLIGSLASGKTSDWIGRRYTIMVAAATFLIGAILMGLAPSFP
FLMAGRVVAGIGVGYSLMISPVYVAELSPALTRGFLTSLPEVFISVGILLGYVSNYAFAGLPNGINWRLMLGLAALPAIA
VALGVLGMPESPRWLVVKGRFEEAKQVLIRTSENKGEAELRLAEIQEAAASAFFTNIDKATTSSRASPTTRMWHGQGVWK
ELLVTPTHTVLRILVAAIGVNFFMQASGNDAVIYYSPEVFKEAGIEGEKQLFGVTIIMGIAKTCFVLISALFLDKFGRRP
MLLLGSCGMAISLFVLGLGCTLLKLSGDNKDEWVIALCVVAVCATVSFFSIGLGPITWVYSSEIFPLRLRAQGSSLAISM
NRLMSGIVSMTFLSVSEAITFGGMFFVLGGVMVCATLFFYFFLPETKGKSLEEIEALFEDQAH*

DNA
ATGGAAGAGAATTCTTCTCTGGAACACCATTATTACTACCCTCTTCCTGCTTCTTCTGCTGCTGCAGAAGCTGATCATCC
TAATAATCACAATGATGGTGACAAAGAAGAGACTTGTGCAGAGGAAGGTAGATCTCAATACAAGCCTAACACATCACAGA
ATTATGTTTCATACCAAAGCAATAGGTCTCGCCTCAACGGATATGCACTTTGTGGTGCTATCTTGGCTTCCACAAACTCC
ATTCTCTTAGGCTATGATATTGGGGTCATGAGTGGTGCTTCTCTTTTTATAAGGCAAGATCTGAAGATCACATCAGTCCA
AGTGGAAATCCTTGTTGGGTCCTTAAATGTGTGCTCCCTGATAGGGTCTCTTGCATCGGGGAAGACTTCTGATTGGATTG
GGAGAAGGTACACTATAATGGTTGCTGCCGCAACATTCCTGATTGGTGCTATTCTGATGGGTTTGGCACCTTCATTTCCA
TTCCTAATGGCAGGTCGTGTAGTTGCAGGCATTGGTGTTGGTTACTCCCTCATGATCTCACCAGTGTATGTTGCTGAGCT
CTCTCCTGCTCTCACCAGAGGCTTTCTCACATCACTCCCTGAAGTCTTCATCAGTGTTGGCATTCTACTTGGTTATGTCT
CCAACTATGCCTTCGCAGGCCTCCCAAATGGCATCAATTGGAGACTCATGCTTGGCCTTGCTGCCTTGCCAGCAATTGCA
GTGGCACTTGGTGTGTTGGGAATGCCCGAGTCTCCTCGCTGGCTTGTAGTGAAGGGAAGGTTTGAGGAAGCAAAACAGGT
TTTGATTAGAACATCAGAGAACAAAGGAGAAGCTGAATTAAGGCTTGCTGAGATACAAGAAGCTGCTGCTTCTGCTTTCT
TCACAAACATTGACAAAGCAACAACTTCTTCCAGGGCCAGTCCAACAACAAGAATGTGGCATGGACAAGGGGTTTGGAAG
GAATTGCTTGTTACACCTACTCACACTGTGTTGAGAATTCTTGTGGCTGCTATTGGTGTTAACTTCTTCATGCAGGCCTC
TGGGAATGATGCTGTGATATATTATAGCCCAGAAGTGTTTAAGGAGGCTGGGATTGAGGGTGAGAAGCAGCTTTTTGGTG
TTACAATCATCATGGGAATAGCCAAGACTTGCTTTGTTTTGATATCAGCCTTGTTCTTGGACAAGTTTGGGAGGAGGCCC
ATGTTGTTGTTGGGCTCATGTGGCATGGCAATCTCATTGTTTGTGTTGGGCTTGGGCTGTACCTTACTTAAGTTATCTGG
TGATAACAAGGATGAATGGGTCATTGCTTTGTGTGTGGTTGCTGTCTGTGCTACTGTATCCTTCTTTTCTATTGGGCTTG
GGCCTATAACTTGGGTCTACTCTTCAGAGATTTTCCCTCTGAGGCTAAGGGCCCAAGGTTCCAGCTTGGCCATTTCTATG
AACCGTTTGATGAGTGGGATTGTGTCCATGACATTCCTTAGTGTTTCAGAGGCAATAACATTTGGAGGCATGTTCTTTGT
GCTTGGTGGGGTGATGGTGTGTGCCACACTTTTCTTTTATTTCTTTTTACCAGAAACCAAAGGCAAGAGCTTAGAAGAGA
TTGAAGCTTTGTTTGAAGATCAAGCACATTGA