Details for Soybean Locus Glyma.09G187200

Position : Chr09 ( 5`- 41192025 .. 41194036 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G187200

Protein [Map View]
MAETLNLPLLLSVCIIFTTLSLTTSRTITTPSHTNVLDVSSSLHQAHQILSFNPQLLEEQSSETETPTSPSSSSSSFSLQ
LHPRETLLNEQHPNYKTLVLSRLARDTARVNSLNTKLQLALSSLNRSDLYPTETELLRPEDLSTPVSSGTAQGSGEYFSR
VGVGQPSKPFYMVLDTGSDVNWLQCKPCSDCYQQSDPIFDPTASSSYNPLTCDAQQCQDLEMSACRNGKCLYQVSYGDGS
FTVGEYVTETVSFGAGSVNRVAIGCGHDNEGLFVGSAGLLGLGGGPLSLTSQIKATSFSYCLVDRDSGKSSTLEFNSPRP
GDSVVAPLLKNQKVNTFYYVELTGVSVGGEIVTVPPETFAVDQSGAGGVIVDSGTAITRLRTQAYNSVRDAFKRKTSNLR
PAEGVALFDTCYDLSSLQSVRVPTVSFHFSGDRAWALPAKNYLIPVDGAGTYCFAFAPTTSSMSIIGNVQQQGTRVSFDL
ANSLVGFSPNKC*

DNA
ATGGCTGAAACTCTAAACCTCCCATTGCTACTCTCAGTCTGCATCATCTTCACAACCCTCTCTCTTACAACCTCTCGCAC
GATCACAACCCCATCACACACCAATGTTCTCGATGTCTCTTCTTCTCTCCACCAAGCCCACCAAATCCTCTCCTTCAACC
CACAACTTCTAGAAGAGCAATCTTCAGAAACAGAAACTCCCACTTCACCATCTTCTTCTTCTTCTTCATTCTCTCTCCAA
CTCCACCCAAGAGAAACCCTCCTCAACGAGCAACACCCCAACTACAAAACCCTAGTTCTCTCCCGACTCGCCCGCGACAC
AGCCCGAGTTAACTCTCTCAACACCAAACTCCAGCTTGCCCTCTCCAGCCTCAACCGGTCGGATCTTTACCCGACCGAAA
CGGAACTGCTCCGACCCGAAGACCTCTCGACGCCGGTCTCCTCCGGCACCGCCCAGGGCAGCGGCGAGTACTTCTCACGC
GTCGGCGTGGGGCAACCCTCGAAGCCCTTCTACATGGTCCTCGACACCGGCTCCGACGTCAACTGGCTCCAATGCAAACC
CTGCTCCGATTGCTACCAACAATCCGACCCGATTTTCGACCCGACAGCGTCCTCCTCGTACAACCCCTTAACCTGCGACG
CACAACAGTGTCAGGACCTCGAAATGTCCGCTTGCAGAAACGGTAAATGCCTCTACCAAGTCTCATACGGTGATGGCTCA
TTCACTGTAGGAGAATACGTCACCGAAACTGTGTCGTTCGGAGCCGGGTCGGTTAATAGGGTCGCAATCGGTTGCGGGCA
TGATAATGAGGGTTTATTCGTTGGGTCCGCTGGGCTTCTTGGGCTTGGTGGTGGGCCTTTGTCATTAACTTCACAAATCA
AAGCGACGTCGTTTTCGTACTGTTTAGTGGATCGCGACTCGGGAAAATCGTCCACGCTCGAGTTCAACTCACCTCGACCC
GGTGACTCGGTCGTTGCACCGTTGTTGAAGAATCAGAAGGTGAACACTTTCTACTACGTGGAGCTCACCGGAGTTAGCGT
CGGCGGGGAAATCGTGACCGTTCCGCCGGAGACTTTTGCCGTTGATCAATCCGGCGCCGGAGGTGTGATTGTGGATTCTG
GAACCGCGATAACTCGGTTGCGGACTCAGGCCTACAACTCGGTGCGCGACGCTTTCAAGAGGAAGACTTCGAACCTGCGT
CCCGCGGAGGGGGTTGCGCTTTTCGACACGTGCTACGACCTGTCGTCTCTGCAGAGCGTGCGGGTGCCGACGGTGTCGTT
TCACTTCAGCGGCGACAGGGCGTGGGCGCTGCCGGCGAAGAATTACTTGATTCCGGTGGACGGTGCCGGGACTTACTGCT
TCGCGTTCGCGCCGACGACGTCGTCTATGTCGATTATTGGGAACGTGCAGCAGCAGGGGACACGTGTCAGCTTCGATCTA
GCAAACTCTTTGGTGGGATTCTCGCCCAACAAGTGCTAG