Details for Soybean Locus Glyma.09G187100

Position : Chr09 ( 5`- 41171964 .. 41188123 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G187100

Protein [Map View]
MEAPPGGSGSGSGPERDKSTAPSSSPISVVSAFWKDFELEKEKSILDEQGLRIAENQENSQRNRRKLAENTRDFKKASPE
DKLSLFNSLLKGYQEEVDNLTKRAKFGENAFLNIYQKLYEAPDPYPALVSIAEQDLKISELESENRKMKVELEEFRTEAT
HLKNQQATIRRLEERNRQLEQQMEEKVKEIVEIKQRSLAEENQKTMEVLKEREQALQDQLQHAKDSVSTMQKLHELAQNQ
LFELRAQSEEERASKQSEVNLLMDEVERAQSMLLSLEREKGVLRNQLQTANEETETKNSDNFDSNSALENSLNAKEKQIS
DLNMELHNIETALSNERDQHINEVKKLTAMLNEKEAALEEMKKELKARPTEKMVDDLRKKVKILQAVGYNSIEAEDWEVA
TSGEEMSKMESLLLDKNRKMEHELTQLKVTLSEKTSILETAEQKIAELTAKSNEQQKLIQKLEDDILKGYSSNSKDRKGN
FLDDWDLSEAGGGEVSENTDQRQVSLDQDQSSMLKVICNQRDRFRTRLRETEEEIRQLKEKIGVLTVELEKSKVDNVKLY
GKIRYVQDYNHEKVVSRGSKKYAEDLESGFMSDVESKYKKIYEDDINPFAAFSKKERDQRYKELGFRDRITLSSGRFLLG
NKYARTFAFFYTIGLHILVFTCLYRMSALSYLSNGPEEFLVGEKNVDLPRGP*

DNA
ATGGAGGCTCCACCAGGTGGATCCGGATCCGGATCCGGACCCGAGCGAGATAAATCCACCGCTCCCTCCTCTTCTCCGAT
CTCCGTCGTCTCCGCCTTCTGGAAAGATTTTGAGTTGGAGAAGGAGAAATCTATATTGGATGAGCAAGGGCTTCGAATTG
CAGAGAACCAGGAAAACAGTCAGAGAAATCGGCGCAAGCTTGCAGAGAACACTAGAGACTTCAAAAAGGCTTCGCCTGAG
GATAAGTTAAGTTTGTTCAATTCCTTGCTTAAGGGCTATCAAGAAGAGGTTGATAATCTTACTAAGAGAGCAAAGTTTGG
AGAAAATGCTTTTCTCAACATCTATCAAAAGCTCTATGAAGCTCCGGATCCTTATCCAGCTCTTGTGTCGATTGCTGAGC
AAGATCTCAAGATATCTGAGCTTGAATCTGAAAACCGGAAAATGAAAGTTGAGCTTGAGGAGTTCAGGACAGAGGCAACT
CACTTGAAGAATCAGCAGGCTACAATACGAAGACTTGAAGAGAGAAACAGGCAATTAGAGCAACAGATGGAAGAGAAAGT
GAAAGAAATTGTGGAGATTAAGCAACGCAGTCTGGCAGAAGAGAATCAGAAAACAATGGAAGTTTTGAAAGAAAGGGAAC
AGGCACTGCAAGATCAGTTGCAGCATGCCAAAGACAGTGTTTCTACTATGCAGAAATTGCATGAACTCGCACAAAACCAG
TTGTTTGAACTCCGCGCCCAATCTGAGGAAGAGAGGGCATCTAAGCAATCAGAGGTCAATCTTCTGATGGATGAAGTGGA
ACGTGCACAATCAATGCTTCTTAGTTTAGAAAGAGAGAAGGGGGTTCTCCGAAATCAGTTGCAAACGGCAAATGAAGAGA
CTGAAACTAAGAATAGTGATAATTTTGACTCAAATAGCGCGCTGGAGAATTCTTTAAATGCCAAAGAAAAACAAATCTCT
GATTTGAACATGGAACTACACAATATTGAAACAGCCTTATCAAATGAAAGAGATCAACACATTAATGAAGTCAAGAAACT
TACGGCCATGCTCAATGAAAAGGAGGCTGCCCTTGAGGAGATGAAGAAAGAACTTAAAGCAAGGCCAACAGAAAAGATGG
TTGATGATCTGCGCAAGAAAGTGAAAATTTTGCAGGCAGTGGGTTATAATTCAATCGAGGCCGAAGACTGGGAAGTGGCT
ACAAGTGGAGAAGAGATGAGCAAGATGGAGTCTCTTCTTCTTGATAAGAACCGTAAAATGGAACATGAACTAACACAGTT
GAAGGTCACGCTTTCTGAGAAAACGTCCATACTGGAAACAGCTGAACAGAAGATAGCAGAACTTACAGCAAAGTCTAATG
AACAACAGAAATTGATACAGAAGTTGGAAGATGATATATTGAAGGGATATAGTTCCAATTCAAAAGACCGTAAAGGGAAC
TTCCTTGATGATTGGGATCTTTCAGAAGCTGGTGGGGGTGAGGTTTCTGAGAATACTGACCAAAGGCAAGTATCCTTAGA
CCAAGATCAGAGCTCAATGCTTAAAGTGATTTGCAATCAAAGAGATCGATTTAGGACCCGCTTGCGAGAGACAGAAGAGG
AAATAAGGCAGTTGAAGGAGAAGATTGGGGTATTAACAGTGGAACTGGAAAAGAGCAAAGTTGATAATGTCAAACTATAC
GGGAAGATTCGTTATGTACAAGACTATAATCATGAGAAAGTGGTTTCTAGGGGTTCTAAAAAGTATGCTGAAGATCTTGA
AAGTGGTTTCATGTCAGATGTGGAATCTAAATACAAGAAGATATATGAGGATGATATAAATCCTTTTGCTGCATTCTCAA
AAAAGGAAAGGGATCAAAGATACAAGGAGTTAGGATTCAGGGACAGAATTACACTCAGCAGTGGACGTTTTCTCCTTGGG
AACAAGTATGCCCGAACTTTCGCATTCTTTTATACCATTGGATTGCATATCTTGGTCTTCACCTGTCTCTACCGAATGTC
TGCTCTCAGTTATCTTAGCAATGGCCCAGAGGAATTCCTTGTCGGAGAGAAAAACGTTGATCTTCCGCGTGGACCATAG