Details for Soybean Locus Glyma.09G184100

Position : Chr09 ( 5`- 40919062 .. 40921935 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G184100

Protein [Map View]
MEENLPPGFRFHPTDEELITCYLTRKVSDSSFTSKAIAVVDLKKSEPWDLPGKASMGKKEWYFFSLRDRKYPTGLRTNRA
TESGYWKTTGKDKEIFRAGVLVGMKKTLVFYRGRAPRGEKSNWVMHEYRLENKNHFRPSKDEWVVCRVFQKSLQMKRPQQ
TPPSQPESPCDTASMVNEFGDVELPNLINNIANSSSDGITNNISGQTFFNADLINSVNTNMNLTMNWPVASEVIQVPTLP
SLPWPSGLLNPSISVNSLLLKALQLRSYQQIEAAAAAATDHLIASYMPQGVSQHVGTNLISSSLTASSSSKVLECVPQQQ
QEQPFNLDSIW*

DNA
ATGGAGGAAAATCTGCCTCCCGGATTCAGGTTCCACCCTACAGACGAAGAGCTCATCACATGTTATCTTACAAGGAAGGT
TTCTGATTCTAGCTTCACATCCAAAGCTATAGCAGTTGTTGATCTCAAGAAGTCTGAACCTTGGGACCTCCCAGGTAAGG
CCTCAATGGGGAAGAAAGAGTGGTACTTCTTTAGCCTAAGAGACCGAAAGTATCCAACAGGACTTCGAACAAACCGAGCC
ACTGAATCAGGGTACTGGAAAACCACAGGGAAAGACAAGGAAATTTTTCGTGCTGGGGTTTTGGTTGGAATGAAGAAAAC
CCTAGTCTTTTATAGGGGTAGAGCTCCAAGGGGCGAGAAAAGCAATTGGGTCATGCACGAATATAGACTAGAAAACAAGA
ATCACTTTAGACCTTCCAAGGACGAATGGGTGGTTTGCAGGGTTTTCCAAAAGAGCTTGCAAATGAAAAGACCACAGCAA
ACACCCCCCTCACAACCAGAGTCCCCATGTGACACAGCCTCAATGGTCAATGAATTTGGTGATGTTGAGCTTCCTAATCT
AATAAATAACATTGCAAATTCTTCATCAGATGGAATCACTAACAACATTTCAGGACAAACCTTCTTCAATGCTGATCTTA
TTAATAGTGTTAACACAAACATGAACTTGACCATGAATTGGCCAGTTGCAAGTGAGGTAATTCAGGTTCCCACTCTTCCA
TCACTTCCATGGCCTTCTGGGTTGTTAAATCCAAGTATTTCTGTAAATTCTTTGCTTCTCAAGGCATTGCAACTTAGGAG
CTATCAACAAATAGAAGCAGCAGCAGCAGCAGCTACAGATCATTTAATTGCATCATATATGCCTCAAGGAGTGTCCCAGC
ATGTTGGAACTAACCTAATTAGTTCAAGTCTCACTGCATCTTCTTCTTCTAAAGTTTTAGAATGTGTTCCACAGCAACAG
CAGGAGCAACCATTCAACTTGGACTCCATTTGGTGA