Details for Soybean Locus Glyma.09G183800

Position : Chr09 ( 5`- 40890646 .. 40898085 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G183800

Protein [Map View]
MSVKKRAFSINIEEAAVDFFNHLLQEKPRIPVFVPLILIAWAIERWVFSASTWVPLALAVWTTIQYGRYQRKLLVEDLDK
KWKRIILNVSPITPLEHCEWLNKLLTEVWSNYFNPKFSIRISAIVEKRLKLRKPRLLERVELQEFSLGSCPPSLALQGMR
WSTIGDQRFLQLGFDWDTNEMSILLLAKLAKPLIGTARIVINSLHIKGDLLASPILDGKALLYSFVSTPEVRIGVAFGSG
GSQSLPATEWPGVSSWLEKLFTDTLAKTMVEPRRRCFTLPAVDLRKKAVGGIIYIRVISANKLSRSCFKTCRRQPNGTSN
GCSEDNFDDKDLQTFVEVEIEELTRRTDVRLGSTPRWDAPFNMVLHDNAGTLRFNLYESCPNNVRCDYLASCEIKLRHVE
DDSTIMWAIGPDSGVIAKQAQFCGEEIEMVVPFEGHNSGELKVSVVVKEWQYSDGSHSLNSLRSSSSQQSINGSPNFQLR
TGRKINVTVVEGKDLAAKDKSGKFDPYIKLQYGKVVQKTRTVHTPNEDRAHVNLEGLVEGSVRDVWIPLERVRSGELRLQ
ISVRADDQEGSKGSGLGLGNGWIELVLIEGRDLVAADVRGTSDPFVRVHYGNFKKKTKVIYKTLNPQWNQTLEFADDGSQ
LMLYVKDHNALLPTSSIGECVVEYQRLPPNQMADKWIPLQGVKRGEIHIQITRKVPEMQKRQSLDSEPSLSKLHQIPIQI
KQMMIKFRSFIEDGNLEGLSTTLSELETLEDTQEGYIVQLETEQMLLLSKIKELGQEIINSSPSLSRRSSSTGN*

DNA
ATGAGCGTGAAGAAAAGGGCATTTTCAATTAACATTGAAGAGGCTGCTGTGGACTTCTTCAACCATCTCTTGCAGGAGAA
GCCTAGGATTCCAGTATTTGTTCCTTTGATTCTGATTGCTTGGGCAATTGAGAGATGGGTCTTCTCTGCCTCCACTTGGG
TTCCTCTTGCACTTGCTGTCTGGACTACTATACAGTACGGGAGATACCAACGCAAACTGCTCGTGGAGGACTTGGATAAG
AAATGGAAGCGAATCATACTGAATGTTTCGCCCATCACACCATTGGAGCACTGTGAGTGGCTGAATAAGTTGTTGACAGA
AGTCTGGTCCAACTATTTTAATCCCAAGTTTTCAATAAGGATATCTGCTATAGTTGAGAAACGTTTAAAGCTCCGGAAAC
CAAGACTTCTAGAAAGAGTTGAACTGCAGGAGTTTTCACTGGGATCGTGCCCTCCTAGCTTGGCTTTGCAAGGGATGCGG
TGGTCAACTATTGGTGATCAGAGATTTCTGCAACTGGGTTTTGACTGGGATACAAATGAAATGAGCATTTTGTTGCTTGC
TAAGCTTGCAAAGCCATTGATTGGAACTGCTCGAATAGTGATTAACAGTCTTCATATCAAGGGTGATCTTCTTGCCTCAC
CTATTCTAGATGGAAAAGCACTTCTGTATTCTTTTGTATCAACTCCTGAAGTGAGAATAGGAGTTGCCTTTGGAAGCGGT
GGAAGCCAATCACTTCCTGCCACTGAATGGCCTGGTGTTTCTTCTTGGCTGGAAAAACTTTTTACTGACACCTTGGCTAA
AACCATGGTGGAACCTCGGCGTCGTTGTTTCACTTTACCTGCTGTTGATTTAAGGAAAAAAGCAGTTGGAGGCATTATAT
ATATTCGAGTGATTTCAGCAAATAAACTTTCTAGGAGTTGCTTTAAGACATGTAGGAGGCAACCAAATGGTACATCCAAT
GGTTGTTCAGAGGATAATTTTGATGATAAGGACCTACAAACATTTGTAGAGGTAGAAATTGAAGAATTAACCAGGAGAAC
AGATGTCAGACTGGGTTCAACCCCCAGATGGGATGCACCATTTAATATGGTTTTACACGATAATGCAGGAACTCTTCGTT
TCAATCTTTATGAGAGTTGTCCCAACAACGTGAGATGTGACTATCTAGCAAGTTGTGAAATCAAGTTGAGGCATGTGGAA
GATGATTCAACGATAATGTGGGCAATAGGACCTGATTCTGGAGTCATAGCAAAGCAAGCACAGTTTTGCGGAGAAGAAAT
TGAAATGGTTGTCCCATTTGAGGGGCACAACTCAGGAGAGTTGAAGGTGAGCGTTGTAGTAAAAGAGTGGCAATATTCTG
ATGGTTCACATAGCTTGAACAGTCTCCGGAGTAGCAGCTCTCAGCAGTCAATTAATGGATCACCAAATTTTCAGTTAAGA
ACTGGAAGAAAAATTAATGTAACTGTTGTGGAAGGAAAGGATCTTGCTGCAAAAGACAAATCTGGAAAGTTTGACCCATA
CATCAAATTGCAGTATGGAAAGGTTGTCCAGAAAACAAGGACGGTTCATACTCCAAACGAAGATCGTGCACATGTGAATT
TGGAAGGACTGGTTGAGGGCTCAGTCAGGGATGTATGGATCCCTCTTGAACGAGTGCGTTCTGGAGAATTAAGACTTCAA
ATATCAGTTAGAGCGGACGACCAAGAAGGATCAAAGGGCTCAGGTTTGGGCTTAGGAAATGGTTGGATTGAACTTGTTCT
GATAGAGGGAAGGGATCTAGTTGCGGCCGATGTCAGAGGCACAAGTGATCCATTTGTGAGGGTACACTACGGAAATTTTA
AGAAAAAGACAAAGGTCATATACAAAACTCTTAACCCTCAGTGGAACCAGACCTTAGAGTTCGCTGATGATGGAAGTCAA
CTAATGCTTTATGTCAAGGATCACAATGCATTGCTACCCACATCAAGTATAGGTGAATGTGTCGTAGAATATCAAAGGTT
ACCTCCAAACCAGATGGCCGACAAGTGGATACCTCTCCAAGGGGTGAAAAGGGGTGAAATTCACATCCAAATTACCAGAA
AAGTTCCAGAGATGCAGAAGAGGCAAAGTCTAGACTCTGAACCTTCCTTGAGTAAACTACACCAAATTCCTATCCAGATA
AAACAGATGATGATCAAGTTCAGGTCCTTCATAGAGGATGGAAATCTTGAAGGACTCTCTACAACATTGAGTGAGCTAGA
AACTCTAGAGGATACACAGGAAGGGTATATAGTCCAGCTGGAGACTGAGCAAATGCTTCTCCTCAGCAAAATAAAGGAAC
TTGGCCAAGAGATCATTAATTCTTCTCCTTCCCTGAGCAGGAGATCTTCTTCAACTGGAAACTGA