Details for Soybean Locus Glyma.09G183700

Position : Chr09 ( 5`- 40881519 .. 40882250 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G183700

Protein [Map View]
MSPSQFHAKKPITSATTNNNINGLLSSPPLKINKESHFIKKSSSSSSSSSSSTSSSLVNSAMTRAMPTSLYKQPQQHHHP
VIIYTHSPKVIHTQPKDFMSLVQKLTGLSRSGEEKEEGGNQSPQQLSNQEFGGDVAAVVGDKESDRKNVNIVKNEDNETS
SVITEENNCSSVGENQVNSCFMTGEPSMLEPKLNPYVTNFPVMAPSSAEFVCSSQPFLNYSDSLFFSHNLRTSLEGMKEF
LEH*

DNA
ATGAGTCCTTCACAATTCCATGCAAAGAAACCAATCACCTCCGCCACCACCAACAACAACATTAATGGATTGCTATCATC
ACCACCTTTGAAAATCAACAAGGAATCTCATTTCATCAAAAAATCATCATCTTCATCATCGTCATCGTCATCATCAACAT
CATCATCCCTTGTTAATAGTGCCATGACACGGGCAATGCCAACGTCATTGTACAAACAACCACAACAACACCACCACCCG
GTAATTATCTACACACATTCTCCAAAGGTCATCCACACTCAGCCTAAGGATTTCATGTCATTGGTGCAAAAGCTCACTGG
CCTCTCTCGCTCAGGAGAGGAGAAAGAGGAGGGTGGCAACCAATCGCCACAACAACTCTCGAACCAAGAATTTGGGGGTG
ATGTTGCGGCGGTGGTGGGAGACAAAGAAAGTGATAGAAAAAATGTGAATATTGTGAAAAATGAGGACAACGAGACATCA
TCGGTAATAACCGAAGAAAACAATTGTAGTAGCGTGGGAGAAAACCAAGTTAACTCTTGTTTCATGACCGGGGAGCCATC
AATGCTAGAGCCTAAGTTGAACCCTTATGTGACAAATTTTCCGGTTATGGCGCCGAGCTCGGCGGAGTTTGTGTGTTCGA
GTCAGCCATTCTTGAATTACTCGGACTCTTTGTTCTTCTCTCATAACTTGAGAACCTCATTGGAAGGGATGAAAGAGTTC
CTTGAGCATTGA