Details for Soybean Locus Glyma.09G183000

Position : Chr09 ( 5`- 40819715 .. 40821469 -3` )
Annotation :
External links : CoGe
PGDD synteny : Glyma.09G183000

Protein [Map View]
MCSETSPPRLSFSHDLSELQVLPMKQGAPCRDTLLHDSNSDFEFITSTDLEFESSSADELFSNGVILPIQMQEKTTARKL
THHVESPHPKLPPRPCASSVDKVKKETIRELLDVNSDNEKKPHSKSFWGFNRSKSLNCDTKKNLVCSSPLLSRSNSTGSV
SNPKRVSSNKHPSAAKSSSSSYSFSTLNMYPMQKSPSGKSYGGSYPNGLRINPVLNVPTPCVSKGSANLLGLGSFLRVGK
VKKSKK*

DNA
ATGTGCTCAGAAACAAGTCCTCCCCGTCTCTCTTTCTCCCATGATCTCTCTGAACTACAAGTTTTACCAATGAAACAAGG
TGCTCCTTGTAGAGACACATTGTTGCATGACTCAAATTCTGACTTCGAGTTCATCACAAGCACCGACCTTGAGTTCGAAT
CGTCTTCAGCAGATGAACTCTTCTCTAATGGGGTGATCCTTCCAATTCAAATGCAAGAAAAAACCACAGCTAGAAAACTC
ACTCACCATGTGGAATCTCCTCACCCAAAACTTCCTCCTCGTCCGTGTGCCTCAAGTGTTGACAAAGTGAAGAAAGAAAC
CATTAGAGAACTCCTAGATGTGAATTCTGATAATGAGAAGAAGCCTCATTCCAAATCCTTTTGGGGATTCAATAGAAGTA
AAAGTCTCAATTGTGATACAAAGAAGAACTTGGTATGCTCTTCACCTCTTTTGTCAAGAAGCAACTCAACAGGTTCAGTG
TCAAATCCAAAGAGAGTGAGTTCAAACAAGCATCCATCAGCTGCTAAATCATCATCATCATCATATTCATTTTCTACCTT
AAATATGTATCCTATGCAAAAATCTCCTTCAGGTAAGAGTTATGGAGGGTCTTATCCCAATGGCCTTAGGATTAATCCTG
TCTTGAACGTACCGACACCTTGTGTTTCGAAGGGAAGTGCAAATCTCTTAGGTTTGGGTTCATTTTTACGTGTTGGGAAG
GTTAAGAAGAGCAAGAAGTGA